Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bovine CRYAB Protein

This Bovine CRYAB Protein spans the amino acid sequence from region 1-175aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Alpha (B) -crystallin)

UniProt

P02510

Expression Region

1-175aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Bos taurus (Bovine)

Field of Research

Cancer Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

27.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDIAIHHPWIRRPFFPFHSPSRLFDQFFGEHLLESDLFPASTSLSPFYLRPPSFLRAPSWIDTGLSEMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHRKYRIPADVDPLAITSSLSSDGVLTVNGPRKQASGPERTIPITREEKPAVTAAPKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N-(2-Propynyl)-2,3-dihydroinden-1-amine
TRC-P839215-50MG 50 mg

N-(2-Propynyl)-2,3-dihydroinden-1-amine

Sign In for Pricing
View Details
Senp5 Mouse Gene Knockout Kit (CRISPR)
KN515516 1 Kit

Senp5 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
FCHSD1 (NM_033449) Human Recombinant Protein
TP315379M 100 µg

FCHSD1 (NM_033449) Human Recombinant Protein

Sign In for Pricing
View Details
Rabbit Tumor Necrosis Factor Beta (TNFb) ELISA Kit
RD-TNFb-Rb-01 96 Tests

Rabbit Tumor Necrosis Factor Beta (TNFb) ELISA Kit

Sign In for Pricing
View Details
Rabbit Tumor Necrosis Factor Beta (TNFb) ELISA Kit
RD-TNFb-Rb-02 48 Tests

Rabbit Tumor Necrosis Factor Beta (TNFb) ELISA Kit

Sign In for Pricing
View Details
STIP1 Antibody (Biotin)
KB-7605-01 50 μL

STIP1 Antibody (Biotin)

Sign In for Pricing
View Details