What is the catalog number for Human FGF 23 Protein (His Tag)?

The catalog number for Human FGF 23 Protein (His Tag) is orb80323.

What sizes are available for Human FGF 23 Protein (His Tag)?

Human FGF 23 Protein (His Tag) is available in the following size(s): 2 µg, 10 µg, 100 µg.

How many pack sizes does Human FGF 23 Protein (His Tag) come in?

Human FGF 23 Protein (His Tag) is available in 3 different pack sizes.

Is Human FGF 23 Protein (His Tag) in stock?

Human FGF 23 Protein (His Tag) is currently made to order / not held in immediate stock. Contact us for lead time.

Human FGF 23 Protein (His Tag)

Recombinant of Human FGF 23 protein (His Tag)

Product Specifications

Product Name Alternative

Tumor-derived hypophosphatemia-inducing factor, HYPF, ADHR, HPDR2, PHPTC, FGF23, FGF-23, Fibroblast Growth Factor-23.

Source

Escherichia Coli

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 90.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.

Bioactivity

Treatment with hrFGF23 has been shown to induce FGFR mediated Erk phosphorylation, reduce plasma PTH levels in rats and to reduce blood phosphate levels.

Form

Sterile Filtered white lyophilized powder.

Solubility

It is recommended to reconstitute the lyophilized Fibroblast Growth Factor-23 in sterile 18MΩ-cm H2O not less than 100μg/ml, which can then be further diluted to other aqueous solutions.

Storage Conditions

Stability: Lyophilized Fibroblast Growth Factor 23 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution FGF-23 should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA) .Please prevent freeze-thaw cycles

Notes

For research use only.

Applications Notes

Cytokines And Growth Factors

Preservative

The protein (0.5mg/ml) was lyophilized from 25mM Tris pH 7.5 and 0.6M NaCl solution.

AA Sequence

MLGARLRLWVCALCSVCSMSVLRAYPNASPLLGSSWGGLIHLYTATARNSYHLQIHKNGHVDGAPHQTIYSALMIRSEDAGFVVITGVMSRRYLCMDFRGNIFGSHYFDPENCRFQHQTLENGYDVYHSPQYHFLVSLGRAKRAFLPGMNPPPYSQFLSRRNEIPLIHFNTPIPRRHTRSAEDDSERDPLNVLKPRARMTPAPASCSQELPSAEDNSPMASDPLGVVRGGRVNTHAGGTGPEGCRPFAKFIHHHHHH