Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TNF-alpha/TNFSF2, Rat (P.pastoris)

Tumour Necrosis Factor alpha (TNF alpha) is a potent pro-inflammatory cytokine[1]. TNF alpha binds to its receptors, mainly TNFR1 and TNFR2, and then transmits molecular signals for biological functions such as inflammation and cell death[2]. TNF alpha stimulates NF-κB pathway via TNFR2 promotes cancer growth, invasion, and metastasis. Anti-TNF-α MAb significantly suppresses the tumor development in colitis-associated cancer (CAC) mouse[3]. TNF alpha as a proneurogenic factor activates the SAPK/JNK Pathway and can facilitate neuronal replacement and brain repair in response to brain injury[4]. TNF-alpha/TNFSF2 Protein, Rat (P.pastoris) is a recombinant protein and is produced in P. pastoris.

Product Specifications

Product Name Alternative

TNF-alpha/TNFSF2 Protein, Rat (P.pastoris), Rat, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tnf-alpha-tnfsf2-protein-rat-p-pastoris.html

Purity

95.00

Smiles

MLRSSSQNSSDKPVAHVVANHQAEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLIYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVSLLSAIKSPCPKDTPEGAELKPWYEPMYLGGVFQLEKGDLLSAEVNLPKYLDITESGQVYFGVIAL

Molecular Formula

24835 (Gene_ID) P16599 (L80-L235) (Accession)

Molecular Weight

Approximately 17.4 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Zelová H, et al. TNF-α signalling and inflammation: interactions between old acquaintances. Inflamm Res. 2013 Jul;62 (7) :641-51.|[2]Horiuchi T, et al. Transmembrane TNF-alpha: structure, function and interaction with anti-TNF agents. Rheumatology (Oxford) . 2010 Jul;49 (7) :1215-28.|[3]El-Tahan RR, et al. TNF-α gene polymorphisms and expression. Springerplus. 2016 Sep 7;5 (1) :1508.|[4]Jang DI, et al. The Role of Tumor Necrosis Factor Alpha (TNF-α) in Autoimmune Disease and Current TNF-α Inhibitors in Therapeutics. Int J Mol Sci. 2021 Mar 8;22 (5) :2719.|[5]Berguetti T, et al. TNF-α Modulates P-Glycoprotein Expression and Contributes to Cellular Proliferation via Extracellular Vesicles. Cells. 2019 May 24;8 (5) :500.|[6]Onizawa M, et al. Signaling pathway via TNF-alpha/NF-kappaB in intestinal epithelial cells may be directly involved in colitis-associated carcinogenesis. Am J Physiol Gastrointest Liver Physiol. 2009 Apr;296 (4) :G850-9.|[7]Bernardino L, et al. Tumor necrosis factor-alpha modulates survival, proliferation, and neuronal differentiation in neonatal subventricular zone cell cultures. Stem Cells. 2008 Sep;26 (9) :2361-71.|[8]Matsuno H, et al. The role of TNF-alpha in the pathogenesis of inflammation and joint destruction in rheumatoid arthritis (RA) : a study using a human RA/SCID mouse chimera. Rheumatology (Oxford) . 2002 Mar;41 (3) :329-37.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

MACROH2A1 Antibody
KC-2486-01 50 μL

MACROH2A1 Antibody

Ask
View Details
MACROH2A1 Antibody
KC-2486-02 100 µL

MACROH2A1 Antibody

Ask
View Details
MACROH2A1 Antibody
KC-2486-03 1 mL

MACROH2A1 Antibody

Ask
View Details
GZMA (Granzyme A (Granzyme 1, Cytotoxic T-Lymphocyte-Associated Serine Esterase 3), CTLA3, HFSP) (Biotin)
246882-Biotin 100 µL

GZMA (Granzyme A (Granzyme 1, Cytotoxic T-Lymphocyte-Associated Serine Esterase 3), CTLA3, HFSP) (Biotin)

Ask
View Details
MUC13 (Mucin 13) Rabbit ELISA Kit
F1207 96 Tests

MUC13 (Mucin 13) Rabbit ELISA Kit

Ask
View Details
Ndufs1 (NM_001160040) Mouse Tagged Lenti ORF Clone
MR219229L3 10 µg

Ndufs1 (NM_001160040) Mouse Tagged Lenti ORF Clone

Ask
View Details