Human HMGB1 Protein
Recombinant of Human HMGB1 protein
Product Specifications
Product Name Alternative
HMG1, HMG3, SBP-1, Amphoterin, HMGB1, High-Mobility Group Box 1.
Source
Escherichia Coli
Purity
Greater than 95.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Form
Sterile Filtered White lyophilized (freeze-dried) powder.
Solubility
It is recommended to reconstitute the lyophilized HMGB1 in sterile 18MΩ-cm H2O not less than 100 μg/ml, which can then be further diluted to other aqueous solutions.
Storage Conditions
Stability: Lyophilized HMGB1 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution HMGB1 should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA) .Please prevent freeze-thaw cycles
Notes
For research use only.
Applications Notes
Recombinant & Natural Proteins
Preservative
The HMG1 (1mg/ml) was lyophilized after extensive dialyses against 1x PBS pH-7.4.
AA Sequence
MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERW KTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPS AFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLK EKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEED EDEEEDDDDELEHHHHHH
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC472218-500 1x 500 µL
CD9 (TSPAN29) (Motility-Related Protein-1) (P1/33/2), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details ![SCP3 (SYCP3) Mouse Monoclonal Antibody [Clone ID: OTI3B8]](https://cdn.genprice.uk/products/937/68dd18b9061270361e907f1a/imageurl/cf806643.webp)
CF806643 100 µg
SCP3 (SYCP3) Mouse Monoclonal Antibody [Clone ID: OTI3B8]
Sign In for Pricing
View Details 
BNC742245-500 1x 500 µL
HSP60 (Heat Shock Protein 60) (Mitochondrial Marker) (CPTC-HSPD1-1), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 