Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human HMGB1 Protein

Recombinant of Human HMGB1 protein

Product Specifications

Product Name Alternative

HMG1, HMG3, SBP-1, Amphoterin, HMGB1, High-Mobility Group Box 1.

Source

Escherichia Coli

Purity

Greater than 95.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.

Form

Sterile Filtered White lyophilized (freeze-dried) powder.

Solubility

It is recommended to reconstitute the lyophilized HMGB1 in sterile 18MΩ-cm H2O not less than 100 μg/ml, which can then be further diluted to other aqueous solutions.

Storage Conditions

Stability: Lyophilized HMGB1 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution HMGB1 should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA) .Please prevent freeze-thaw cycles

Notes

For research use only.

Applications Notes

Recombinant & Natural Proteins

Preservative

The HMG1 (1mg/ml) was lyophilized after extensive dialyses against 1x PBS pH-7.4.

AA Sequence

MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERW KTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPS AFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLK EKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEED EDEEEDDDDELEHHHHHH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDX2 Antibody
KC-6134-01 50 μL

CDX2 Antibody

Sign In for Pricing
View Details
CDX2 Antibody
KC-6134-02 100 µL

CDX2 Antibody

Sign In for Pricing
View Details
CDX2 Antibody
KC-6134-03 1 mL

CDX2 Antibody

Sign In for Pricing
View Details
ZG16B Human Gene Knockout Kit (CRISPR)
KN202244RB 1 Kit

ZG16B Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
DLL4 Mouse Monoclonal Antibody [Clone ID: 4A11F8/4A11G2]
AM06777PU-N 100 µg

DLL4 Mouse Monoclonal Antibody [Clone ID: 4A11F8/4A11G2]

Sign In for Pricing
View Details
Frozen Tissue Sections, Neural tissue
CS622565 5x 5 µm

Frozen Tissue Sections, Neural tissue

Sign In for Pricing
View Details