Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human HMGB1 Protein

Recombinant of Human HMGB1 protein

Product Specifications

Product Name Alternative

HMG1, HMG3, SBP-1, Amphoterin, HMGB1, High-Mobility Group Box 1.

Source

Escherichia Coli

Purity

Greater than 95.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.

Form

Sterile Filtered White lyophilized (freeze-dried) powder.

Solubility

It is recommended to reconstitute the lyophilized HMGB1 in sterile 18MΩ-cm H2O not less than 100 μg/ml, which can then be further diluted to other aqueous solutions.

Storage Conditions

Stability: Lyophilized HMGB1 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution HMGB1 should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA) .Please prevent freeze-thaw cycles

Notes

For research use only.

Applications Notes

Recombinant & Natural Proteins

Preservative

The HMG1 (1mg/ml) was lyophilized after extensive dialyses against 1x PBS pH-7.4.

AA Sequence

MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERW KTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPS AFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLK EKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEED EDEEEDDDDELEHHHHHH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

c20orf72 (MGME1) (NM_052865) Human Over-expression Lysate
LC403263 20 µg

c20orf72 (MGME1) (NM_052865) Human Over-expression Lysate

Sign In for Pricing
View Details
R Cadherin (CDH4) (NM_001794) Human Over-expression Lysate
LY400684 100 µg

R Cadherin (CDH4) (NM_001794) Human Over-expression Lysate

Sign In for Pricing
View Details
Ulifloxacin
TRC-U700700-500MG 500 mg

Ulifloxacin

Sign In for Pricing
View Details
CCDC140 Antibody
KC-2932-01 50 μL

CCDC140 Antibody

Sign In for Pricing
View Details
CCDC140 Antibody
KC-2932-02 100 µL

CCDC140 Antibody

Sign In for Pricing
View Details
CCDC140 Antibody
KC-2932-03 1 mL

CCDC140 Antibody

Sign In for Pricing
View Details