Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ICAM1 (HEK) Protein

Recombinant of human ICAM1 (HEK) protein

Product Specifications

Product Name Alternative

Intercellular adhesion molecule 1, ICAM-1, Major group rhinovirus receptor, CD54 antigen, ICAM1, BB2, CD54, P3.58.

Source

HEK293 cells

Field of Research

Immunology & Inflammation

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Sterile Filtered White lyophilized (freeze-dried) powder.

Solubility

It is recommended to reconstitute the lyophilized ICAM1 in 1xPBS to a concentration no less than 100 μg/ml, which can then be further diluted to other aqueous solutions.

Storage Conditions

Stability: Lyophilized ICAM1 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution ICAM1 should be stored at 4°C between 2-7 days and for future use below -18°C. Please prevent freeze-thaw cycles

Notes

For research use only.

Applications Notes

Recombinant & Natural Proteins

Preservative

ICAM1 was lyophilized from a 0.2 μM filtered solution of 20mM PB and 150mM NaCl, pH 7.2.

AA Sequence

QTSVSPSKVILPRGGSVLVTCSTSCDQPKLLGIETPLPKKELLLPGNNRKVYELSNVQEDSQPMCYSNCPDGQSTAKTFLTVYWTPERVELAPLPSWQPVGKNLTLRCQVEGGAPRANLTVVLLRGEKELKREPAVGEPAEVTTTVLVRRDHHGANFSCRTELDLRPQGLELFENTSAPYQLQTFVLPATPPQLVSPRVLEVDTQGTVVCSLDGLFPVSEAQVHLALGDQRLNPTVTYGNDSFSAKASVSVTAEDEGTQRLTCAVILGNQSQETLQTVTIYSFPAPNVILTKPEVSEGTEVTVKCEAHPRAKVTLNGVPAQPLGPRAQLLLKATPEDNGRSFSCSATLEVAGQLIHKNQTRELRVLYGPRLDERDCPGNWTWPENSQQTPMCQAWGNPLPELKCLKDGTFPLPIGESVTVTRDLEGTYLCRARSTQGEVTRKVTVNVLSPRYEVDHHHHHH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Brip1 3'UTR Luciferase Stable Cell Line
TU102846 1.0 mL

Brip1 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
P4HB Rabbit mAb Antibody
orb3015057 100 µL

P4HB Rabbit mAb Antibody

Sign In for Pricing
View Details
Phospho-LIMK1-T508/LIMK2-T505 polyclonal antibody
BS74155-01 50 µL

Phospho-LIMK1-T508/LIMK2-T505 polyclonal antibody

Sign In for Pricing
View Details
Phospho-LIMK1-T508/LIMK2-T505 polyclonal antibody
BS74155-02 100 µL

Phospho-LIMK1-T508/LIMK2-T505 polyclonal antibody

Sign In for Pricing
View Details
Lce1i sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K3270705 3x 1.0 µg

Lce1i sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Rabbit Anti EVA1A Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4) (Western Blot,IHC,ELISA)
IRBAMLEVA1AAP926120UL 1 Each

Rabbit Anti EVA1A Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4) (Western Blot,IHC,ELISA)

Sign In for Pricing
View Details