Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ICAM1 (HEK) Protein

Recombinant of human ICAM1 (HEK) protein

Product Specifications

Product Name Alternative

Intercellular adhesion molecule 1, ICAM-1, Major group rhinovirus receptor, CD54 antigen, ICAM1, BB2, CD54, P3.58.

Source

HEK293 cells

Field of Research

Immunology & Inflammation

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Sterile Filtered White lyophilized (freeze-dried) powder.

Solubility

It is recommended to reconstitute the lyophilized ICAM1 in 1xPBS to a concentration no less than 100 μg/ml, which can then be further diluted to other aqueous solutions.

Storage Conditions

Stability: Lyophilized ICAM1 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution ICAM1 should be stored at 4°C between 2-7 days and for future use below -18°C. Please prevent freeze-thaw cycles

Notes

For research use only.

Applications Notes

Recombinant & Natural Proteins

Preservative

ICAM1 was lyophilized from a 0.2 μM filtered solution of 20mM PB and 150mM NaCl, pH 7.2.

AA Sequence

QTSVSPSKVILPRGGSVLVTCSTSCDQPKLLGIETPLPKKELLLPGNNRKVYELSNVQEDSQPMCYSNCPDGQSTAKTFLTVYWTPERVELAPLPSWQPVGKNLTLRCQVEGGAPRANLTVVLLRGEKELKREPAVGEPAEVTTTVLVRRDHHGANFSCRTELDLRPQGLELFENTSAPYQLQTFVLPATPPQLVSPRVLEVDTQGTVVCSLDGLFPVSEAQVHLALGDQRLNPTVTYGNDSFSAKASVSVTAEDEGTQRLTCAVILGNQSQETLQTVTIYSFPAPNVILTKPEVSEGTEVTVKCEAHPRAKVTLNGVPAQPLGPRAQLLLKATPEDNGRSFSCSATLEVAGQLIHKNQTRELRVLYGPRLDERDCPGNWTWPENSQQTPMCQAWGNPLPELKCLKDGTFPLPIGESVTVTRDLEGTYLCRARSTQGEVTRKVTVNVLSPRYEVDHHHHHH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chicken Gamma-Secretase (GS) ELISA Kit
MBS9390071 Inquire

Chicken Gamma-Secretase (GS) ELISA Kit

Sign In for Pricing
View Details
Rabbit Polyclonal Acetyl-CoA Carboxylase alpha/ACACA Antibody [DyLight 594]
NB100-55247DL594 0.1 mL

Rabbit Polyclonal Acetyl-CoA Carboxylase alpha/ACACA Antibody [DyLight 594]

Sign In for Pricing
View Details
Ser/thr-PP2A activator (PTPA) Rabbit pAb (APR24455N)
APR24455N-01 50 µL

Ser/thr-PP2A activator (PTPA) Rabbit pAb (APR24455N)

Sign In for Pricing
View Details
Ser/thr-PP2A activator (PTPA) Rabbit pAb (APR24455N)
APR24455N-02 100 µL

Ser/thr-PP2A activator (PTPA) Rabbit pAb (APR24455N)

Sign In for Pricing
View Details
Ser/thr-PP2A activator (PTPA) Rabbit pAb (APR24455N)
APR24455N-03 200 µL

Ser/thr-PP2A activator (PTPA) Rabbit pAb (APR24455N)

Sign In for Pricing
View Details
VSNL1 Protein
OPPA01774-2UG 2 µg

VSNL1 Protein

Sign In for Pricing
View Details