Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MIF, Human

MIF Protein, Human has assumed an important role as a pivotal regulator of innate immunity. MIF Protein, Human promotes the pro-inflammatory functions of immune cells.

Product Specifications

Product Name Alternative

MIF Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Applications

Neuroscience-Neuromodulation

Assay Protocol

https://www.medchemexpress.com/cytokines/mif-protein-human.html

Purity

98.0

Smiles

MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA

Molecular Formula

4282 (Gene_ID) P14174 (M1-A115) (Accession)

Molecular Weight

Approximately 12.5 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Calandra T, et al. Macrophage migration inhibitory factor: a regulator of innate immunity. Nat Rev Immunol. 2003 Oct;3 (10) :791-800.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VEZT sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K2610706 1.0 µg DNA

VEZT sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Rabbit Polyclonal N4BP1 Antibody [Alexa Fluor 750]
NBP1-76531AF750 0.1 mL

Rabbit Polyclonal N4BP1 Antibody [Alexa Fluor 750]

Sign In for Pricing
View Details
Anti-SARS-CoV-2 S Protein Nanobody (SAA1057)
VK474473-01 50 µg

Anti-SARS-CoV-2 S Protein Nanobody (SAA1057)

Sign In for Pricing
View Details
Anti-SARS-CoV-2 S Protein Nanobody (SAA1057)
VK474473-02 100 µg

Anti-SARS-CoV-2 S Protein Nanobody (SAA1057)

Sign In for Pricing
View Details
Anti-SARS-CoV-2 S Protein Nanobody (SAA1057)
VK474473-03 1 mg

Anti-SARS-CoV-2 S Protein Nanobody (SAA1057)

Sign In for Pricing
View Details
Calystegine A7
orb1991356-01 1 mg

Calystegine A7

Sign In for Pricing
View Details