Tpc1808 Protein
Recombinant of Tpc1808 protein
Product Specifications
Product Name Alternative
Tropic 1808, Tpc1808.
Source
Escherichia Coli
Purity
Greater than 95.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Form
Sterile Filtered White lyophilized (freeze-dried) powder.
Storage Conditions
Stability: Lyophilized Tpc1808 although stable 10°C for 1 week, should be stored desiccated below -18°C.Please prevent freeze-thaw cycles
Notes
For research use only.
Applications Notes
Recombinant & Natural Proteins
Preservative
The Tropic-1808 was lyophilized from 1X PBS, pH 7.4.
AA Sequence
MSYYHHHHHHMNLAQIAALNQISNLNAIRVGQVLKVSNAAGSNNTQNTTQPSAGVPTNTASSTTGYTVKSGDTLSAIAAANGVSLANLLSWNNLSLQAIIYPGQKLTIQNANNATVTTPNAPTSTPTVMPSTNGSYTVKSGDTLYGIAAKLGTNVQTLLSLNGLQLSSTIYVGQVLKTTGAVAGAGTATSTPTPVTPTVSKPAAANGVSTAGLSAAQAAWLRTAVVDAQAATAGTGVLASVTVAQAILESGWGQSALASAPYHNFNLYLIKVKNTWKLMTLLLS
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1263207-01 0.02 mg (E-Coli)
Recombinant Thermotoga petrophila 1-deoxy-D-xylulose 5-phosphate reductoisomerase (dxr)
Sign In for Pricing
View Details MBS1263207-02 0.02 mg (Yeast)
Recombinant Thermotoga petrophila 1-deoxy-D-xylulose 5-phosphate reductoisomerase (dxr)
Sign In for Pricing
View Details MBS1263207-03 0.1 mg (E-Coli)
Recombinant Thermotoga petrophila 1-deoxy-D-xylulose 5-phosphate reductoisomerase (dxr)
Sign In for Pricing
View Details MBS1263207-04 0.1 mg (Yeast)
Recombinant Thermotoga petrophila 1-deoxy-D-xylulose 5-phosphate reductoisomerase (dxr)
Sign In for Pricing
View Details MBS1263207-05 0.02 mg (Baculovirus)
Recombinant Thermotoga petrophila 1-deoxy-D-xylulose 5-phosphate reductoisomerase (dxr)
Sign In for Pricing
View Details MBS1263207-06 0.02 mg (Mammalian-Cell)
Recombinant Thermotoga petrophila 1-deoxy-D-xylulose 5-phosphate reductoisomerase (dxr)
Sign In for Pricing
View Details