Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tpc1808 Protein

Recombinant of Tpc1808 protein

Product Specifications

Product Name Alternative

Tropic 1808, Tpc1808.

Source

Escherichia Coli

Purity

Greater than 95.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.

Form

Sterile Filtered White lyophilized (freeze-dried) powder.

Storage Conditions

Stability: Lyophilized Tpc1808 although stable 10°C for 1 week, should be stored desiccated below -18°C.Please prevent freeze-thaw cycles

Notes

For research use only.

Applications Notes

Recombinant & Natural Proteins

Preservative

The Tropic-1808 was lyophilized from 1X PBS, pH 7.4.

AA Sequence

MSYYHHHHHHMNLAQIAALNQISNLNAIRVGQVLKVSNAAGSNNTQNTTQPSAGVPTNTASSTTGYTVKSGDTLSAIAAANGVSLANLLSWNNLSLQAIIYPGQKLTIQNANNATVTTPNAPTSTPTVMPSTNGSYTVKSGDTLYGIAAKLGTNVQTLLSLNGLQLSSTIYVGQVLKTTGAVAGAGTATSTPTPVTPTVSKPAAANGVSTAGLSAAQAAWLRTAVVDAQAATAGTGVLASVTVAQAILESGWGQSALASAPYHNFNLYLIKVKNTWKLMTLLLS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GIT2 Antibody
MBS8514012-01 0.1 mg

GIT2 Antibody

Sign In for Pricing
View Details
GIT2 Antibody
MBS8514012-02 0.1 mL (AF635)

GIT2 Antibody

Sign In for Pricing
View Details
GIT2 Antibody
MBS8514012-03 0.1 mL (AF610)

GIT2 Antibody

Sign In for Pricing
View Details
GIT2 Antibody
MBS8514012-04 0.1 mL (AF405S)

GIT2 Antibody

Sign In for Pricing
View Details
GIT2 Antibody
MBS8514012-05 0.1 mL (AF405L)

GIT2 Antibody

Sign In for Pricing
View Details
GIT2 Antibody
MBS8514012-06 0.1 mL (AF546)

GIT2 Antibody

Sign In for Pricing
View Details