Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human SELE (HEK) Protein

Recombinant of human SELE (HEK) protein

Product Specifications

Product Name Alternative

E-selectin, Endothelial leukocyte adhesion molecule 1, ELAM-1, Leukocyte-endothelial cell adhesion molecule 2, LECAM2, CD62E antigen, SELE, ELAM1, ELAM, ESEL, CD62E.

Source

HEK293 cells

Field of Research

Immunology & Inflammation

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Sterile Filtered White lyophilized (freeze-dried) powder.

Solubility

It is recommended to reconstitute the lyophilized SELE in 1xPBS to a concentration no less than 100 μg/ml, which can then be further diluted to other aqueous solutions.

Storage Conditions

Stability: Lyophilized SELE although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution SELE should be stored at 4°C between 2-7 days and for future use below -18°C. Please prevent freeze-thaw cycles

Notes

For research use only.

Applications Notes

Recombinant & Natural Proteins

Preservative

SELE was lyophilized from a 0.2 μM filtered solution of PBS and 4% Mannitol, pH 7.5.

AA Sequence

WSYNTSTEAMTYDEASAYCQQRYTHLVAIQNKEEIEYLNSILSYSPSYYWIGIRKVNNVWVWVGTQKPLTEEAKNWAPGEPNNRQKDEDCVEIYIKREKDVGMWNDERCSKKKLALCYTAACTNTSCSGHGECVETINNYTCKCDPGFSGLKCEQIVNCTALESPEHGSLVCSHPLGNFSYNSSCSISCDRGYLPSSMETMQCMSSGEWSAPIPACNVVECDAVTNPANGFVECFQNPGSFPWNTTCTFDCEEGFELMGAQSLQCTSSGNWDNEKPTCKAVTCRAVRQPQNGSVRCSHSPAGEFTFKSSCNFTCEEGFMLQGPAQVECTTQGQWTQQIPVCEAFQCTALSNPERGYMNCLPSASGSFRYGSSCEFSCEQGFVLKGSKRLQCGPTGEWDNEKPTCEAVRCDAVHQPPKGLVRCAHSPIGEFTYKSSCAFSCEEGFELHGSTQLECTSQGQWTEEVPSCQVVKCSSLAVPGKINMSCSGEPVFGTVCKFACPEGWTLNGSAARTCGATGHWSGLLPTCEAPTESNIPVDHHHHHH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AMG-47a 100mg
A13167-100 100 mg

AMG-47a 100mg

Sign In for Pricing
View Details
Mouse Matrix MetalloProteinase 3 (MMP-3) ELISA Kit
JL12259-01 48 Tests

Mouse Matrix MetalloProteinase 3 (MMP-3) ELISA Kit

Sign In for Pricing
View Details
Mouse Matrix MetalloProteinase 3 (MMP-3) ELISA Kit
JL12259-02 96 Tests

Mouse Matrix MetalloProteinase 3 (MMP-3) ELISA Kit

Sign In for Pricing
View Details
Guinea pig Anti-Skeletalmuscle Antibody ELISA Kit
MBS753353-01 48 Well

Guinea pig Anti-Skeletalmuscle Antibody ELISA Kit

Sign In for Pricing
View Details
Guinea pig Anti-Skeletalmuscle Antibody ELISA Kit
MBS753353-02 96 Well

Guinea pig Anti-Skeletalmuscle Antibody ELISA Kit

Sign In for Pricing
View Details
Guinea pig Anti-Skeletalmuscle Antibody ELISA Kit
MBS753353-03 5x 96 Well

Guinea pig Anti-Skeletalmuscle Antibody ELISA Kit

Sign In for Pricing
View Details