What is the catalog number for Omp Pylori Protein?

The catalog number for Omp Pylori Protein is orb81246.

What sizes are available for Omp Pylori Protein?

Omp Pylori Protein is available in the following size(s): 100 µg, 0.5 mg, 1 mg.

How many pack sizes does Omp Pylori Protein come in?

Omp Pylori Protein is available in 3 different pack sizes.

Is Omp Pylori Protein in stock?

Omp Pylori Protein is currently made to order / not held in immediate stock. Contact us for lead time.

Omp Pylori Protein

Recombinant of Omp Pylori protein

Product Specifications

Source

E.Coli

Field of Research

Infectious Disease & Virology

Purity

Greater than 95% pure as determined by 12% PAGE (Coomassie staining) .

Form

Sterile filtered liquid formulation.

Storage Conditions

Stability: Omp Pylori although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles

Notes

For research use only.

Applications Notes

Recombinant & Natural Proteins

Preservative

The Omp Pylori recombinant protein is formulated in 1xPBS pH 7.4.

AA Sequence

MLVTKLAPDFKAPAVLGNNEVDEHFELSKNLGKNGAILFFWPKDFTFVCPTEIIAFDKRVKDFQEKGFNVIGVSIDSEQVHFAWKNTPVEKGGIGQVTFPMVADITKSISRDYDVLFEEAIALRGAFLIDKNMKVRHAVINDLPLGRNADEMLRMVDALLHFEEHGEVCPAGWRKGDKGMKATHQGVAEYLKENSIKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

10450075-1 100 ml

Nucleosome ChIP Sonication Buffer 2X

Sign In for Pricing

View Details

OPCD05308-50UG 50 µg

MMP11 Recombinant Protein

Sign In for Pricing

View Details

NBP1-97731FR 0.1 mL

Mouse Monoclonal Integrin alpha 3B Antibody (PB36) [DyLight 680]

Sign In for Pricing

View Details

orb470794 100 µL

Ficolin 2 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing

View Details

RC215546L4 10 µg

PLEKHM1 (NM_014798) Human Tagged Lenti ORF Clone

Sign In for Pricing

View Details

MBS154821-01 0.1 mg

TMPRSS2 (CT) Antibody

Sign In for Pricing

View Details