Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Omp Pylori Protein

Recombinant of Omp Pylori protein

Product Specifications

Source

E.Coli

Field of Research

Infectious Disease & Virology

Purity

Greater than 95% pure as determined by 12% PAGE (Coomassie staining) .

Form

Sterile filtered liquid formulation.

Storage Conditions

Stability: Omp Pylori although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles

Notes

For research use only.

Applications Notes

Recombinant & Natural Proteins

Preservative

The Omp Pylori recombinant protein is formulated in 1xPBS pH 7.4.

AA Sequence

MLVTKLAPDFKAPAVLGNNEVDEHFELSKNLGKNGAILFFWPKDFTFVCPTEIIAFDKRVKDFQEKGFNVIGVSIDSEQVHFAWKNTPVEKGGIGQVTFPMVADITKSISRDYDVLFEEAIALRGAFLIDKNMKVRHAVINDLPLGRNADEMLRMVDALLHFEEHGEVCPAGWRKGDKGMKATHQGVAEYLKENSIKL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CLIM-1/2 (A-3) : m-IgG2b BP-HRP Bundle
sc-549074 1 Kit

CLIM-1/2 (A-3) : m-IgG2b BP-HRP Bundle

Sign In for Pricing
View Details
DNAH9 Rabbit Polyclonal Antibody (PerCP-Cy5.5)
orb2546559 100 µL

DNAH9 Rabbit Polyclonal Antibody (PerCP-Cy5.5)

Sign In for Pricing
View Details
Imidazole-4-carboxylic acid
abx184126-01 1 g

Imidazole-4-carboxylic acid

Sign In for Pricing
View Details
Imidazole-4-carboxylic acid
abx184126-02 5 g

Imidazole-4-carboxylic acid

Sign In for Pricing
View Details
Imidazole-4-carboxylic acid
abx184126-03 25 g

Imidazole-4-carboxylic acid

Sign In for Pricing
View Details
BPIL1 (BPIFB2) (NM_025227) Human Tagged Lenti ORF Clone
RC206378L4 10 µg

BPIL1 (BPIFB2) (NM_025227) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details