What is the catalog number for Omp Pylori Protein?

The catalog number for Omp Pylori Protein is orb81246.

What sizes are available for Omp Pylori Protein?

Omp Pylori Protein is available in the following size(s): 100 µg, 0.5 mg, 1 mg.

How many pack sizes does Omp Pylori Protein come in?

Omp Pylori Protein is available in 3 different pack sizes.

Is Omp Pylori Protein in stock?

Omp Pylori Protein is currently made to order / not held in immediate stock. Contact us for lead time.

Omp Pylori Protein

Recombinant of Omp Pylori protein

Product Specifications

Source

E.Coli

Field of Research

Infectious Disease & Virology

Purity

Greater than 95% pure as determined by 12% PAGE (Coomassie staining) .

Form

Sterile filtered liquid formulation.

Storage Conditions

Stability: Omp Pylori although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles

Notes

For research use only.

Applications Notes

Recombinant & Natural Proteins

Preservative

The Omp Pylori recombinant protein is formulated in 1xPBS pH 7.4.

AA Sequence

MLVTKLAPDFKAPAVLGNNEVDEHFELSKNLGKNGAILFFWPKDFTFVCPTEIIAFDKRVKDFQEKGFNVIGVSIDSEQVHFAWKNTPVEKGGIGQVTFPMVADITKSISRDYDVLFEEAIALRGAFLIDKNMKVRHAVINDLPLGRNADEMLRMVDALLHFEEHGEVCPAGWRKGDKGMKATHQGVAEYLKENSIKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ES12953-01 50 µL

SRP09 rabbit pAb

Sign In for Pricing

View Details

ES12953-02 100 µL

SRP09 rabbit pAb

Sign In for Pricing

View Details

sc-430351-ACT-2 20 µg

AKAP 9 CRISPR Activation Plasmid (m2)

Sign In for Pricing

View Details

sc-204970 25 µg

(±) 11-HETE

Sign In for Pricing

View Details

MBS6336938-01 0.1 mL

PRAMEF16, CT (PRAMEF16, PRAME family member 16) (MaxLight 750)

Sign In for Pricing

View Details

MBS6336938-02 5x 0.1 mL

PRAMEF16, CT (PRAMEF16, PRAME family member 16) (MaxLight 750)

Sign In for Pricing

View Details