Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Omp Pylori Protein

Recombinant of Omp Pylori protein

Product Specifications

Source

E.Coli

Field of Research

Infectious Disease & Virology

Purity

Greater than 95% pure as determined by 12% PAGE (Coomassie staining) .

Form

Sterile filtered liquid formulation.

Storage Conditions

Stability: Omp Pylori although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles

Notes

For research use only.

Applications Notes

Recombinant & Natural Proteins

Preservative

The Omp Pylori recombinant protein is formulated in 1xPBS pH 7.4.

AA Sequence

MLVTKLAPDFKAPAVLGNNEVDEHFELSKNLGKNGAILFFWPKDFTFVCPTEIIAFDKRVKDFQEKGFNVIGVSIDSEQVHFAWKNTPVEKGGIGQVTFPMVADITKSISRDYDVLFEEAIALRGAFLIDKNMKVRHAVINDLPLGRNADEMLRMVDALLHFEEHGEVCPAGWRKGDKGMKATHQGVAEYLKENSIKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ANGPTL4 ORF Vector (Human) (pORF)
11900011 1.0 µg DNA

ANGPTL4 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
V5 Tag
301785 100 µg

V5 Tag

Sign In for Pricing
View Details
N1-Acetylspermine-d3 Trihydrochloride
T210719-01 10 mg

N1-Acetylspermine-d3 Trihydrochloride

Sign In for Pricing
View Details
N1-Acetylspermine-d3 Trihydrochloride
T210719-02 50 mg

N1-Acetylspermine-d3 Trihydrochloride

Sign In for Pricing
View Details
IGFBP1 Rabbit Polyclonal Antibody (Fluoro488)
orb3076619 100 µg

IGFBP1 Rabbit Polyclonal Antibody (Fluoro488)

Sign In for Pricing
View Details
Human TIGIT Knockout HEK293T cell line
GTR15416728 1 Vial

Human TIGIT Knockout HEK293T cell line

Sign In for Pricing
View Details