Human SPARC Protein
Recombinant of human SPARC protein
Product Specifications
Product Name Alternative
Osteonectin, ON, Basement-membrane protein 40, BM-40, SPARC, Secreted Protein acidic and Rich in Cysteine.
Source
Escherichia Coli
Field of Research
Musculoskeletal & Connective Tissue Research
Purity
Greater than 95.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Form
Sterile Filtered White lyophilized (freeze-dried) powder.
Solubility
It is recommended to reconstitute the lyophilized SPARC in sterile 18MΩ-cm H2O not less than 100 μg/ml, which can then be further diluted to other aqueous solutions.
Storage Conditions
Stability: Lyophilized Osteonectin although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution BM-40 should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA) .Please prevent freeze-thaw cycles
Notes
For research use only.
Applications Notes
Recombinant & Natural Proteins
Preservative
The SPARC (1 mg/ml) was lyophilized after extensive dialyses against 20mM PBS pH-7.4.
AA Sequence
MSYYHHHHHHPQQEALPDETEVVEETVAEVTEVSVGANPVQVEVGEFDDGAEETEEEVVAENPCQNHHCKHGKVCELDENNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHKLHLDYIGPCKYIPPCLDSELTEFPLRMRDWLKNVLVTLYERDEDNNLLTKQKLRVKKIHENEKRLEAGDHPVELLARDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKYIALDEWAGCFGIKQKDIDKDLVI
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
abx481103 96 Tests
Mouse IL4/IL5/IL13/IFNG/CCL11/TNF/IL10/IL1b Multiplex Assay Kit
Sign In for Pricing
View Details 
280085-01 500 mg
4- (3-Hydroxyprop-1-yn-1-yl) thiophene-2-carbaldehyde
Sign In for Pricing
View Details 280085-02 1 g
4- (3-Hydroxyprop-1-yn-1-yl) thiophene-2-carbaldehyde
Sign In for Pricing
View Details