Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Streptavidin Protein

Recombinant of Streptavidin protein

Product Specifications

Source

Escherichia Coli

Purity

Greater than 98.0% as determined by SDS-PAGE and HPLC.

Form

Sterile Filtered White lyophilized (freeze-dried) powder.

Solubility

It is recommended to reconstitute the lyophilized Streptavidin in sterile 18MΩ-cm H2O not less than 0.5mg/ml, which can then be further diluted to other aqueous solutions.

Storage Conditions

Stability: Streptavidin is shipped at ambient temperature, upon arrival store at -20°C

Notes

For research use only.

Applications Notes

Proteolytic Activity: < 10-3 U/mg protein (Azocoll, 25 °C, 24 h, pH 8.0)

Preservative

Lyophilized in 10mM potassium phosphate buffer pH 6.5.

AA Sequence

MAEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKVKPSAAS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sheep Cullin associated NEDD8 dissociated protein 2 (CAND2) ELISA kit
GTR10409119 96 Well

Sheep Cullin associated NEDD8 dissociated protein 2 (CAND2) ELISA kit

Sign In for Pricing
View Details
P130 Cas (Phospho-Tyr410) Antibody
orb127749-01 25 µg

P130 Cas (Phospho-Tyr410) Antibody

Sign In for Pricing
View Details
P130 Cas (Phospho-Tyr410) Antibody
orb127749-02 50 µg

P130 Cas (Phospho-Tyr410) Antibody

Sign In for Pricing
View Details
P130 Cas (Phospho-Tyr410) Antibody
orb127749-03 100 µg

P130 Cas (Phospho-Tyr410) Antibody

Sign In for Pricing
View Details
P130 Cas (Phospho-Tyr410) Antibody
orb127749-04 200 µg

P130 Cas (Phospho-Tyr410) Antibody

Sign In for Pricing
View Details
Mouse Apoc3 qPCR Primer Pair
QM09710S 200 Tests

Mouse Apoc3 qPCR Primer Pair

Sign In for Pricing
View Details