Streptavidin Protein
Recombinant of Streptavidin protein
Product Specifications
Source
Escherichia Coli
Purity
Greater than 98.0% as determined by SDS-PAGE and HPLC.
Form
Sterile Filtered White lyophilized (freeze-dried) powder.
Solubility
It is recommended to reconstitute the lyophilized Streptavidin in sterile 18MΩ-cm H2O not less than 0.5mg/ml, which can then be further diluted to other aqueous solutions.
Storage Conditions
Stability: Streptavidin is shipped at ambient temperature, upon arrival store at -20°C
Notes
For research use only.
Applications Notes
Proteolytic Activity: < 10-3 U/mg protein (Azocoll, 25 °C, 24 h, pH 8.0)
Preservative
Lyophilized in 10mM potassium phosphate buffer pH 6.5.
AA Sequence
MAEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKVKPSAAS
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR15384995 1 Vial
Lentiviral human S100P sgRNA gene knockout kit - Lentiviral human S100P sgRNA gene knockout kit (plasmid)
Sign In for Pricing
View Details 
RC205714L4V 200 µL
SH3BP5L (NM_030645) Human Tagged ORF Clone Lentiviral Particle
Sign In for Pricing
View Details