Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SARS MERS Protein

Recombinant of SARS MERS protein

Product Specifications

Source

Escherichia Coli

Field of Research

Infectious Disease & Virology

Purity

Protein is >95% pure as determined by 10% PAGE (coomassie staining) .

Form

Sterile filtered clear solution.

Storage Conditions

Stability: Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA) .Avoid multiple freeze-thaw cycles

Notes

For research use only.

Applications Notes

Applications: Immunoassay

Preservative

SARS MERS protein solution is supplied in PBS, 25mM arginine and 0.05% sodium azide.

AA Sequence

EAKPSGSVVEQAEGVECDFSPLLSGTPPQVYNFKRLVFTNCNYNLTKLLSLFSVNDFTCSQISPAAIASNCYSSLILDYFSYPLSMKSDLSVSSAGPISQFNYKQSFSNPTCLILATVPHNLTTITKPLKYSYINKCSRLLSDDRTEVPQLVNANQYSPCVSIVPSTVWEDGDYYRKQLSPLEGGGWLVASGSTVAMTEQLQMGFGITVQYGTDTNSVCPKLEFANDTKIASQLGNCVEYHHHHHH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SRGN Rabbit Polyclonal Antibody (BF405)
orb2397763 100 µL

SRGN Rabbit Polyclonal Antibody (BF405)

Sign In for Pricing
View Details
P2RY6 3'UTR Luciferase Stable Cell Line
TU017257 1.0 mL

P2RY6 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Lentiviral mouse Klk15 shRNA (UAS) - Lentiviral mouse Klk15 shRNA (UAS) (25)
GTR15229289 1 Vial

Lentiviral mouse Klk15 shRNA (UAS) - Lentiviral mouse Klk15 shRNA (UAS) (25)

Sign In for Pricing
View Details
HAS1
552970 100 µg

HAS1

Sign In for Pricing
View Details
TRAPPC3L (NM_001139444) Human Over-expression Lysate
LS100128327-20ug 20 µg

TRAPPC3L (NM_001139444) Human Over-expression Lysate

Sign In for Pricing
View Details
HIV1 Vif Antibody [P7N1]
C20465-50uL 50 μL

HIV1 Vif Antibody [P7N1]

Sign In for Pricing
View Details