Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SARS MERS Protein

Recombinant of SARS MERS protein

Product Specifications

Source

Escherichia Coli

Field of Research

Infectious Disease & Virology

Purity

Protein is >95% pure as determined by 10% PAGE (coomassie staining) .

Form

Sterile filtered clear solution.

Storage Conditions

Stability: Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA) .Avoid multiple freeze-thaw cycles

Notes

For research use only.

Applications Notes

Applications: Immunoassay

Preservative

SARS MERS protein solution is supplied in PBS, 25mM arginine and 0.05% sodium azide.

AA Sequence

EAKPSGSVVEQAEGVECDFSPLLSGTPPQVYNFKRLVFTNCNYNLTKLLSLFSVNDFTCSQISPAAIASNCYSSLILDYFSYPLSMKSDLSVSSAGPISQFNYKQSFSNPTCLILATVPHNLTTITKPLKYSYINKCSRLLSDDRTEVPQLVNANQYSPCVSIVPSTVWEDGDYYRKQLSPLEGGGWLVASGSTVAMTEQLQMGFGITVQYGTDTNSVCPKLEFANDTKIASQLGNCVEYHHHHHH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Kanokoside A
T124485-01 1 mg

Kanokoside A

Sign In for Pricing
View Details
Kanokoside A
T124485-02 5 mg

Kanokoside A

Sign In for Pricing
View Details
Anti-LC3 (T50) MAP1LC3B Antibody
A01524T50 100 µL

Anti-LC3 (T50) MAP1LC3B Antibody

Sign In for Pricing
View Details
Canine cluster Of differentiation, CD134 ELISA Kit
MBS7236601-01 48 Well

Canine cluster Of differentiation, CD134 ELISA Kit

Sign In for Pricing
View Details
Canine cluster Of differentiation, CD134 ELISA Kit
MBS7236601-02 96 Well

Canine cluster Of differentiation, CD134 ELISA Kit

Sign In for Pricing
View Details
Canine cluster Of differentiation, CD134 ELISA Kit
MBS7236601-03 5x 96 Well

Canine cluster Of differentiation, CD134 ELISA Kit

Sign In for Pricing
View Details