Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CoV-2 N (1-419) Protein

Recombinant Coronavirus 2019 Nucleocapsid (1-419 a.a.)

Product Specifications

Source

E.Coli

Field of Research

Infectious Disease & Virology

Purity

Protein is >95% pure as determined SDS-PAGE.

Form

Sterile Filtered White lyophilized (freeze-dried) powder.

Solubility

It is recommended to reconstitute the lyophilized CoV-2 protein in sterile 18MΩ-cm H2O not less than 100μg/ml, which can then be further diluted to other aqueous solutions.

Storage Conditions

Stability: Cov-2 Nucleocapsid phosphoprotein is shipped lyophilized at ambient temp. Although stable at room temperature for 2 weeks, should be stored desiccated below -18°C. Upon reconstitution COV2 should be stored at 4°C between 2-7 days and for future use below -18°C. Please prevent freeze-thaw cycles

Notes

For research use only.

Applications Notes

Viral Antigens- Sars Proteins

Preservative

CoV-2 Nucleocapsid phosphoprotein was lyophilized from 20mM Na-carbonate buffer pH-9.2

AA Sequence

MSDNGPQNQRNAPRITFGGPSDSTGSNQNGERSGARSKQRRPQGLPNNTASWFTALTQHGKED LKFPRGQGVPINTNSSPDDQIGYYRRATRRIRGGDGKMKDLSPRWYFYYLGTGPEAGLPYGANK DGIIWVATEGALNTPKDHIGTRNPANNAAIVLQLPQGTTLPKGFYAEGSRGGSQASSRSSSRSRN SSRNSTPGSSRGTSPARMAGNGGDAALALLLLDRLNQLESKMSGKGQQQQGQTVTKKSAAEAS KKPRQKRTATKAYNVTQAFGRRGPEQTQGNFGDQELIRQGTDYKHWPQIAQFAPSASAFFGMSR IGMEVTPSGTWLTYTGAIKLDDKDPNFKDQVILLNKHIDAYKTFPPTEPKKDKKKKADETQALPQR QKKQQTVTLLPAADLDDFSKQLQQSMSSADSTQAHHHHHH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-Human EIF4EBP1 pAb
PA10373-01 50 μL

Rabbit Anti-Human EIF4EBP1 pAb

Sign In for Pricing
View Details
Rabbit Anti-Human EIF4EBP1 pAb
PA10373-02 100 μL

Rabbit Anti-Human EIF4EBP1 pAb

Sign In for Pricing
View Details
MASP1/MASP3 Rabbit Polyclonal Antibody (Biotin)
orb457848 100 µL

MASP1/MASP3 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
SOCS5 (Suppressor of Cytokine Signaling 5, SOCS-5, Cytokine-inducible SH2 Protein 6, CIS6, CIS-6, CISH6, Cytokine-inducible SH2-containing Protein 5, CISH5, KIAA0671) (MaxLight 550)
133690-ML550 100 µL

SOCS5 (Suppressor of Cytokine Signaling 5, SOCS-5, Cytokine-inducible SH2 Protein 6, CIS6, CIS-6, CISH6, Cytokine-inducible SH2-containing Protein 5, CISH5, KIAA0671) (MaxLight 550)

Sign In for Pricing
View Details
UNKL Protein Lysate
OCOA15870-20UG 20 µg

UNKL Protein Lysate

Sign In for Pricing
View Details
CD1a (CB-T6), 0.2mg/mL
BNUB0157-500 1x 500 µL

CD1a (CB-T6), 0.2mg/mL

Sign In for Pricing
View Details