HSV-2 gB Protein
Recombinant of HSV-2 gB protein
Product Specifications
Source
Escherichia Coli
Field of Research
Infectious Disease & Virology
Purity
Protein is >90% pure as determined by SDS PAGE.
Form
Sterile Filtered clear solution.
Storage Conditions
Stability: HSV-2 gB although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles
Notes
For research use only.
Applications Notes
Applications: ELISA, WB, Flow-Through
Preservative
10mM Phosphate buffer pH 7.6 and 75mM NaCl.
AA Sequence
MIAPYKFKATMYYKDVTVSQVWFGHRYSQFMGIFEDRAPVPFEEVIDKINAKGVCRST AKYVRNNLETTAFHRDDHETDMELKPANAATRTSRGWHTTDLKYNPSRVEAFHRYGTTVNCIVEEVDARSVYPYDEFVLATGDFVYMSPFYGYREGSHTEHTSYAADRFKQVDGFYARDLTTKARATAPTTRNLLTTPKFTVAWDWVPKRPSVCTHHHHHH
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC042198-100 1x 100 µL
NKX2.2 (Neuroendocrine & Ewing's Sarcoma Marker) (NX2/2198R), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC042828-100 1x 100 µL
GPX4 / MCSP (LHM 2), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC741968-500 1x 500 µL
Thyroglobulin (Thyroidal Cell Marker) (TGB/1968R), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNCB1862-500 1x 500 µL
CD79a (B-Cell Marker) (rIGA/764), Biotin conjugate, 0.1mg/mL
Sign In for Pricing
View Details