Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HSV-2 gB Protein

Recombinant of HSV-2 gB protein

Product Specifications

Source

Escherichia Coli

Field of Research

Infectious Disease & Virology

Purity

Protein is >90% pure as determined by SDS PAGE.

Form

Sterile Filtered clear solution.

Storage Conditions

Stability: HSV-2 gB although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles

Notes

For research use only.

Applications Notes

Applications: ELISA, WB, Flow-Through

Preservative

10mM Phosphate buffer pH 7.6 and 75mM NaCl.

AA Sequence

MIAPYKFKATMYYKDVTVSQVWFGHRYSQFMGIFEDRAPVPFEEVIDKINAKGVCRST AKYVRNNLETTAFHRDDHETDMELKPANAATRTSRGWHTTDLKYNPSRVEAFHRYGTTVNCIVEEVDARSVYPYDEFVLATGDFVYMSPFYGYREGSHTEHTSYAADRFKQVDGFYARDLTTKARATAPTTRNLLTTPKFTVAWDWVPKRPSVCTHHHHHH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N-Succinimidyl 3- (Bromoacetamido) propionate
T16250-01 100 mg

N-Succinimidyl 3- (Bromoacetamido) propionate

Sign In for Pricing
View Details
N-Succinimidyl 3- (Bromoacetamido) propionate
T16250-02 500 mg

N-Succinimidyl 3- (Bromoacetamido) propionate

Sign In for Pricing
View Details
Anti-RING-box protein 2 RNF7 Antibody
A05620-1 100 µL

Anti-RING-box protein 2 RNF7 Antibody

Sign In for Pricing
View Details
Cyclin E (BSA & Azide Free) (Biotin) discontinued
C8455-10X-Biotin 100 µL

Cyclin E (BSA & Azide Free) (Biotin) discontinued

Sign In for Pricing
View Details
Lentiviral human C19orf54 shRNA (UAS) - Lentiviral human C19orf54 shRNA (UAS) (25)
GTR15092753 1 Vial

Lentiviral human C19orf54 shRNA (UAS) - Lentiviral human C19orf54 shRNA (UAS) (25)

Sign In for Pricing
View Details
AKT3 (RAC-gamma Serine/Threonine-protein Kinase, Protein Kinase Akt-3, Protein Kinase B gamma, PKB gamma, RAC-PK-gamma, STK-2, PKBG) (Biotin)
MBS6369387-01 0.1 mL

AKT3 (RAC-gamma Serine/Threonine-protein Kinase, Protein Kinase Akt-3, Protein Kinase B gamma, PKB gamma, RAC-PK-gamma, STK-2, PKBG) (Biotin)

Sign In for Pricing
View Details