Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HSV-2 gB Protein

Recombinant of HSV-2 gB protein

Product Specifications

Source

Escherichia Coli

Field of Research

Infectious Disease & Virology

Purity

Protein is >90% pure as determined by SDS PAGE.

Form

Sterile Filtered clear solution.

Storage Conditions

Stability: HSV-2 gB although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles

Notes

For research use only.

Applications Notes

Applications: ELISA, WB, Flow-Through

Preservative

10mM Phosphate buffer pH 7.6 and 75mM NaCl.

AA Sequence

MIAPYKFKATMYYKDVTVSQVWFGHRYSQFMGIFEDRAPVPFEEVIDKINAKGVCRST AKYVRNNLETTAFHRDDHETDMELKPANAATRTSRGWHTTDLKYNPSRVEAFHRYGTTVNCIVEEVDARSVYPYDEFVLATGDFVYMSPFYGYREGSHTEHTSYAADRFKQVDGFYARDLTTKARATAPTTRNLLTTPKFTVAWDWVPKRPSVCTHHHHHH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cy3-Linked Polyclonal Antibody to Protein Tyrosine Phosphatase Receptor Type Q (PTPRQ)
MBS2072040-01 0.1 mL

Cy3-Linked Polyclonal Antibody to Protein Tyrosine Phosphatase Receptor Type Q (PTPRQ)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Protein Tyrosine Phosphatase Receptor Type Q (PTPRQ)
MBS2072040-02 0.2 mL

Cy3-Linked Polyclonal Antibody to Protein Tyrosine Phosphatase Receptor Type Q (PTPRQ)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Protein Tyrosine Phosphatase Receptor Type Q (PTPRQ)
MBS2072040-03 0.5 mL

Cy3-Linked Polyclonal Antibody to Protein Tyrosine Phosphatase Receptor Type Q (PTPRQ)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Protein Tyrosine Phosphatase Receptor Type Q (PTPRQ)
MBS2072040-04 1 mL

Cy3-Linked Polyclonal Antibody to Protein Tyrosine Phosphatase Receptor Type Q (PTPRQ)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Protein Tyrosine Phosphatase Receptor Type Q (PTPRQ)
MBS2072040-05 5 mL

Cy3-Linked Polyclonal Antibody to Protein Tyrosine Phosphatase Receptor Type Q (PTPRQ)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Protein Tyrosine Phosphatase Receptor Type Q (PTPRQ)
MBS2072040-06 5x 5 mL

Cy3-Linked Polyclonal Antibody to Protein Tyrosine Phosphatase Receptor Type Q (PTPRQ)

Sign In for Pricing
View Details