What is the catalog number for HCV Genotype 1b (170 aa) Protein?

The catalog number for HCV Genotype 1b (170 aa) Protein is orb426051.

What sizes are available for HCV Genotype 1b (170 aa) Protein?

HCV Genotype 1b (170 aa) Protein is available in the following size(s): 100 µg, 0.5 mg, 1 mg.

How many pack sizes does HCV Genotype 1b (170 aa) Protein come in?

HCV Genotype 1b (170 aa) Protein is available in 3 different pack sizes.

Is HCV Genotype 1b (170 aa) Protein in stock?

HCV Genotype 1b (170 aa) Protein is currently made to order / not held in immediate stock. Contact us for lead time.

HCV Genotype 1b (170 aa) Protein

Recombinant of HCV Genotype 1b (170 aa) protein

Product Specifications

Source

Escherichia Coli

Purity

Greater than 95.0% as determined by SDS-PAGE.

Form

Sterile filtered colorless solution.

Storage Conditions

Stability: Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA) . Avoid multiple freeze-thaw cycles

Notes

For research use only.

Applications Notes

Viral Antigens- Hepatitis C Virus

Preservative

Sterile filtered solution containing 1x PBS and 25mM Arginine.

AA Sequence

MKETAAAKFERQHMDSPDLGTLVPRGSMADIGSSTNPKPQRKTKRNTNRRPQDVKFPGGGQIVGGVYLLPRRGPRLGVRATRKTSERSQPRGWRQPIPKARRPEGRAWAQPGYPWPLYGNEGLGWAGWLLSPRGSRPSWGPTDPRRRSRNLGKVIDTLTCGFADLMGYIPLVGAPLGGAARALAHGVRVLEDGVNYATGNLPVDKLAAALEHHHHHH*