Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HCV NS4 a+b Protein

Recombinant of HCV NS4 a+b protein

Product Specifications

Field of Research

Cancer Biology

Purity

HCV NS4 a+b protein is >95% pure as determined by 10% PAGE (coomassie staining) .

Storage Conditions

Stability: HCV NS4 a+b although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles

Notes

For research use only.

Applications Notes

Applications: HCV NS4 a+b antigen is suitable for ELISA and Western blots, excellent antigen for detection of HCV with minimal specificity problems

Preservative

20mM Tris-HCl pH 8, 8M urea.

AA Sequence

1658 TWVLVGGVLAALAAYCLSTGCVVIVGRVVLSGKPAIIPDREVLYREFDEMEECSQHLPYIEQGMMLAEQFKQKALGLLQTASRQAEVIAPAVQTNWQKLETFWAKHMWNFISGIQYLAGLSTLPGNPAIASLMAFTAAVTSPLTTSQTLLFNILGGWVAAQLAAPGAATAFVGAGLAGAAIGSVGLGKVLIDILAGYGAGVAGAL 1863

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Rat AN1-type zinc finger protein 6 (Zfand6)
MBS1305040-01 0.02 mg (E-Coli)

Recombinant Rat AN1-type zinc finger protein 6 (Zfand6)

Sign In for Pricing
View Details
Recombinant Rat AN1-type zinc finger protein 6 (Zfand6)
MBS1305040-02 0.1 mg (E-Coli)

Recombinant Rat AN1-type zinc finger protein 6 (Zfand6)

Sign In for Pricing
View Details
Recombinant Rat AN1-type zinc finger protein 6 (Zfand6)
MBS1305040-03 0.02 mg (Yeast)

Recombinant Rat AN1-type zinc finger protein 6 (Zfand6)

Sign In for Pricing
View Details
Recombinant Rat AN1-type zinc finger protein 6 (Zfand6)
MBS1305040-04 0.1 mg (Yeast)

Recombinant Rat AN1-type zinc finger protein 6 (Zfand6)

Sign In for Pricing
View Details
Recombinant Rat AN1-type zinc finger protein 6 (Zfand6)
MBS1305040-05 0.02 mg (Baculovirus)

Recombinant Rat AN1-type zinc finger protein 6 (Zfand6)

Sign In for Pricing
View Details
Recombinant Rat AN1-type zinc finger protein 6 (Zfand6)
MBS1305040-06 0.02 mg (Mammalian-Cell)

Recombinant Rat AN1-type zinc finger protein 6 (Zfand6)

Sign In for Pricing
View Details