HCV NS4 a+b Protein
Recombinant of HCV NS4 a+b protein
Product Specifications
Field of Research
Cancer Biology
Purity
HCV NS4 a+b protein is >95% pure as determined by 10% PAGE (coomassie staining) .
Storage Conditions
Stability: HCV NS4 a+b although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles
Notes
For research use only.
Applications Notes
Applications: HCV NS4 a+b antigen is suitable for ELISA and Western blots, excellent antigen for detection of HCV with minimal specificity problems
Preservative
20mM Tris-HCl pH 8, 8M urea.
AA Sequence
1658 TWVLVGGVLAALAAYCLSTGCVVIVGRVVLSGKPAIIPDREVLYREFDEMEECSQHLPYIEQGMMLAEQFKQKALGLLQTASRQAEVIAPAVQTNWQKLETFWAKHMWNFISGIQYLAGLSTLPGNPAIASLMAFTAAVTSPLTTSQTLLFNILGGWVAAQLAAPGAATAFVGAGLAGAAIGSVGLGKVLIDILAGYGAGVAGAL 1863
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![Methyl 4’-[[2-n-Propyl-4-methyl-6- (1-methylbenzimidazol-2-yl) -benzimidazol-1-yl]methyl]biphenyl-2-carboxylate](https://cdn.genprice.uk/genprice/uk/genprice3.webp)
M3533-15 50 mg
Methyl 4’-[[2-n-Propyl-4-methyl-6- (1-methylbenzimidazol-2-yl) -benzimidazol-1-yl]methyl]biphenyl-2-carboxylate
Sign In for Pricing
View Details 
MBS6245126-01 0.1 mL
Syntrophin (dystrophin-associated protein A1, 59kD, basic component 1, 59-DAP, 59kD dystrophin-associated protein A1 basic component 1, A1B, Beta-1-syntrophin, BSYN2, DAPA1B, FLJ22442, MGC111389, SNT2, SNT2B1, Syntrophin-2, Tax interaction protein 43, TIP
Sign In for Pricing
View Details MBS6245126-02 5x 0.1 mL
Syntrophin (dystrophin-associated protein A1, 59kD, basic component 1, 59-DAP, 59kD dystrophin-associated protein A1 basic component 1, A1B, Beta-1-syntrophin, BSYN2, DAPA1B, FLJ22442, MGC111389, SNT2, SNT2B1, Syntrophin-2, Tax interaction protein 43, TIP
Sign In for Pricing
View Details 
