HCV NS4 a+b Protein
Recombinant of HCV NS4 a+b protein
Product Specifications
Field of Research
Cancer Biology
Purity
HCV NS4 a+b protein is >95% pure as determined by 10% PAGE (coomassie staining) .
Storage Conditions
Stability: HCV NS4 a+b although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles
Notes
For research use only.
Applications Notes
Applications: HCV NS4 a+b antigen is suitable for ELISA and Western blots, excellent antigen for detection of HCV with minimal specificity problems
Preservative
20mM Tris-HCl pH 8, 8M urea.
AA Sequence
1658 TWVLVGGVLAALAAYCLSTGCVVIVGRVVLSGKPAIIPDREVLYREFDEMEECSQHLPYIEQGMMLAEQFKQKALGLLQTASRQAEVIAPAVQTNWQKLETFWAKHMWNFISGIQYLAGLSTLPGNPAIASLMAFTAAVTSPLTTSQTLLFNILGGWVAAQLAAPGAATAFVGAGLAGAAIGSVGLGKVLIDILAGYGAGVAGAL 1863
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
035840-Biotin 200 µL
GABARAPL1 (GABARAPL1, GEC1, Gamma-aminobutyric acid receptor-associated protein-like 1, Early estrogen-regulated protein, GABA (A) receptor-associated protein-like 1, Glandular epithelial cell protein 1) (Biotin) discontinued
Sign In for Pricing
View Details 
GC2006-250mg 250 mg
2,3,4,6-Tetra-O-benzoyl-β-D-glucopyranosyl fluoride
Sign In for Pricing
View Details orb3006778-01 20 µg
Recombinant Human Transmembrane protein 217B (T217B), partial
Sign In for Pricing
View Details orb3006778-02 100 µg
Recombinant Human Transmembrane protein 217B (T217B), partial
Sign In for Pricing
View Details orb3006778-03 1 mg
Recombinant Human Transmembrane protein 217B (T217B), partial
Sign In for Pricing
View Details C2405-11P-ML650 100 µL
CD51 (CD51 Antigen, Integrin alpha V, ITGAV, Msk8, Vitronectin Receptor alpha Polypeptide, Vitronectin Receptor Subunit alpha, VNRA) (MaxLight 650)
Sign In for Pricing
View Details