Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HCV NS4 a+b Protein

Recombinant of HCV NS4 a+b protein

Product Specifications

Field of Research

Cancer Biology

Purity

HCV NS4 a+b protein is >95% pure as determined by 10% PAGE (coomassie staining) .

Storage Conditions

Stability: HCV NS4 a+b although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles

Notes

For research use only.

Applications Notes

Applications: HCV NS4 a+b antigen is suitable for ELISA and Western blots, excellent antigen for detection of HCV with minimal specificity problems

Preservative

20mM Tris-HCl pH 8, 8M urea.

AA Sequence

1658 TWVLVGGVLAALAAYCLSTGCVVIVGRVVLSGKPAIIPDREVLYREFDEMEECSQHLPYIEQGMMLAEQFKQKALGLLQTASRQAEVIAPAVQTNWQKLETFWAKHMWNFISGIQYLAGLSTLPGNPAIASLMAFTAAVTSPLTTSQTLLFNILGGWVAAQLAAPGAATAFVGAGLAGAAIGSVGLGKVLIDILAGYGAGVAGAL 1863

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

mmu-miR-29b-3p Primers
MPM01085 150 µL / 10 µM

mmu-miR-29b-3p Primers

Sign In for Pricing
View Details
Recombinant Human T cell receptor beta constant 1 (TRBC1), partial
CSB-EP024291HU1-01 20 µg

Recombinant Human T cell receptor beta constant 1 (TRBC1), partial

Sign In for Pricing
View Details
Recombinant Human T cell receptor beta constant 1 (TRBC1), partial
CSB-EP024291HU1-02 100 µg

Recombinant Human T cell receptor beta constant 1 (TRBC1), partial

Sign In for Pricing
View Details
Recombinant Human T cell receptor beta constant 1 (TRBC1), partial
CSB-EP024291HU1-03 1 mg

Recombinant Human T cell receptor beta constant 1 (TRBC1), partial

Sign In for Pricing
View Details
Anti-PDHX Rabbit pAb
GB114143-100 100 μL

Anti-PDHX Rabbit pAb

Sign In for Pricing
View Details
Thyroid Stimulating Hormone alpha (TSHa) (MaxLight 405) discontinued
T5400-21-ML405 100 µL

Thyroid Stimulating Hormone alpha (TSHa) (MaxLight 405) discontinued

Sign In for Pricing
View Details