Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hantavirus Protein

The Hantavirus nucleocapsid (N) fusion protein protein is expressed in E.coli and fused to GST-tag having Mw of 37 kDa. Hantavirus nucleocapsid (N) is conserved among different strains, and is used to test the specific IgM and IgG to Hantavirus.

Product Specifications

Product Name Alternative

HTNV, Hantaan Virus, Hantanvirus.

Source

E.Coli

Purity

HTNV protein is >95% pure as determined by 12% PAGE (coomassie staining) .

Form

Sterile filtered colorless solution.

Storage Conditions

Stability: Upon arrival, Store at -20°C. Please avoid multiple freeze/thaw cycles

Notes

For research use only.

Applications Notes

Viral Antigens- Hantaan Virus

Preservative

HTNV is formulated in 1xPBS pH-7.4 and 0.05% Sodium azide.

AA Sequence

GSMATMEELQREINAHEGQLVIARQKVRDAEKQYEKDPDELNKRTLTDRE GVAVSIQAKIDELKRQLADRIATGKNLGKEQDPTGVEPGDHLKERSMLSY GNVLDLNHLDIDEPTGQTADWLSIVVYVD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Complement C4d (C4D204), CF640R conjugate, 0.1mg/mL
BNC400204-500 1x 500 µL

Complement C4d (C4D204), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD63 (MX-49.129.5), CF647 conjugate, 0.1mg/mL
BNC470525-500 1x 500 µL

CD63 (MX-49.129.5), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (HFN7.1), CF405S conjugate, 0.1mg/mL
BNC040270-500 1x 500 µL

Fibronectin (HFN7.1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD63 (MX-49.129.5), CF555 conjugate, 0.1mg/mL
BNC550525-500 1x 500 µL

CD63 (MX-49.129.5), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fascin-1 (FSCN1/417), CF647 conjugate, 0.1mg/mL
BNC470417-100 1x 100 µL

Fascin-1 (FSCN1/417), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details