Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hantavirus Protein

The Hantavirus nucleocapsid (N) fusion protein protein is expressed in E.coli and fused to GST-tag having Mw of 37 kDa. Hantavirus nucleocapsid (N) is conserved among different strains, and is used to test the specific IgM and IgG to Hantavirus.

Product Specifications

Product Name Alternative

HTNV, Hantaan Virus, Hantanvirus.

Source

E.Coli

Purity

HTNV protein is >95% pure as determined by 12% PAGE (coomassie staining) .

Form

Sterile filtered colorless solution.

Storage Conditions

Stability: Upon arrival, Store at -20°C. Please avoid multiple freeze/thaw cycles

Notes

For research use only.

Applications Notes

Viral Antigens- Hantaan Virus

Preservative

HTNV is formulated in 1xPBS pH-7.4 and 0.05% Sodium azide.

AA Sequence

GSMATMEELQREINAHEGQLVIARQKVRDAEKQYEKDPDELNKRTLTDRE GVAVSIQAKIDELKRQLADRIATGKNLGKEQDPTGVEPGDHLKERSMLSY GNVLDLNHLDIDEPTGQTADWLSIVVYVD

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human APOA5 (Apolipoprotein A5) ELISA Kit
ELK2741-01 48 Tests

Human APOA5 (Apolipoprotein A5) ELISA Kit

Sign In for Pricing
View Details
Human APOA5 (Apolipoprotein A5) ELISA Kit
ELK2741-02 96 Tests

Human APOA5 (Apolipoprotein A5) ELISA Kit

Sign In for Pricing
View Details
Human APOA5 (Apolipoprotein A5) ELISA Kit
ELK2741-03 5x 96 Tests

Human APOA5 (Apolipoprotein A5) ELISA Kit

Sign In for Pricing
View Details
X-17-432-CL-BK AF Systems Consumables
806807 Roll of 350 Label(s)

X-17-432-CL-BK AF Systems Consumables

Sign In for Pricing
View Details
ZNF260 Polyclonal Antibody, PE-Cy5.5 Conjugated
bs-7201R-PE-Cy5.5 100 µL

ZNF260 Polyclonal Antibody, PE-Cy5.5 Conjugated

Sign In for Pricing
View Details
Pin1 (NM_023371) Mouse Tagged Lenti ORF Clone
MR201342L3 10 µg

Pin1 (NM_023371) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details