Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hantavirus Protein

The Hantavirus nucleocapsid (N) fusion protein protein is expressed in E.coli and fused to GST-tag having Mw of 37 kDa. Hantavirus nucleocapsid (N) is conserved among different strains, and is used to test the specific IgM and IgG to Hantavirus.

Product Specifications

Product Name Alternative

HTNV, Hantaan Virus, Hantanvirus.

Source

E.Coli

Purity

HTNV protein is >95% pure as determined by 12% PAGE (coomassie staining) .

Form

Sterile filtered colorless solution.

Storage Conditions

Stability: Upon arrival, Store at -20°C. Please avoid multiple freeze/thaw cycles

Notes

For research use only.

Applications Notes

Viral Antigens- Hantaan Virus

Preservative

HTNV is formulated in 1xPBS pH-7.4 and 0.05% Sodium azide.

AA Sequence

GSMATMEELQREINAHEGQLVIARQKVRDAEKQYEKDPDELNKRTLTDRE GVAVSIQAKIDELKRQLADRIATGKNLGKEQDPTGVEPGDHLKERSMLSY GNVLDLNHLDIDEPTGQTADWLSIVVYVD

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

1,3-βD Glucosidase (1,3-βD-Glu) Chicken ELISA Kit
B0027 96 Tests

1,3-βD Glucosidase (1,3-βD-Glu) Chicken ELISA Kit

Sign In for Pricing
View Details
TPD52L1 Blocking Peptide
MBS9627855-01 1 mg

TPD52L1 Blocking Peptide

Sign In for Pricing
View Details
TPD52L1 Blocking Peptide
MBS9627855-02 5x 1 mg

TPD52L1 Blocking Peptide

Sign In for Pricing
View Details
Cry2 Antibody
62-137 400 µL

Cry2 Antibody

Sign In for Pricing
View Details
FFAR4 Rabbit pAb
E918689 100 µL

FFAR4 Rabbit pAb

Sign In for Pricing
View Details
LIPC 3'UTR Luciferase Stable Cell Line
TU012499 1.0 mL

LIPC 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details