Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HBsAg adw2 Protein

Recombinant of HBsAg adw2 protein

Product Specifications

Source

Escherichia Coli

Purity

Greater than 90.0% as determined by SDS-PAGE.

Form

Sterile filtered colorless solution.

Storage Conditions

Stability: Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA) . Avoid multiple freeze-thaw cycles

Notes

For research use only.

Applications Notes

Viral Antigens- Hepatitis B Surface Antigens

Preservative

Sterile filtered solution containing 50mM potassium phosphate.

AA Sequence

MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNH SPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGP CKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFV QWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AMAC1L1 CRISPRa sgRNA lentivector (set of three targets)(Human)
52668121 3x 1.0µg DNA

AMAC1L1 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
GFAP Monoclonal Antibody
bsm-42001M 100 µL

GFAP Monoclonal Antibody

Sign In for Pricing
View Details
AMACR/p504s Monoclonal Antibody
MBS2579950-01 0.1 mL

AMACR/p504s Monoclonal Antibody

Sign In for Pricing
View Details
AMACR/p504s Monoclonal Antibody
MBS2579950-02 0.2 mL

AMACR/p504s Monoclonal Antibody

Sign In for Pricing
View Details
AMACR/p504s Monoclonal Antibody
MBS2579950-03 1 mL

AMACR/p504s Monoclonal Antibody

Sign In for Pricing
View Details
AMACR/p504s Monoclonal Antibody
MBS2579950-04 5x 1 mL

AMACR/p504s Monoclonal Antibody

Sign In for Pricing
View Details