Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HBsAg adw2 Protein

Recombinant of HBsAg adw2 protein

Product Specifications

Source

Escherichia Coli

Purity

Greater than 90.0% as determined by SDS-PAGE.

Form

Sterile filtered colorless solution.

Storage Conditions

Stability: Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA) . Avoid multiple freeze-thaw cycles

Notes

For research use only.

Applications Notes

Viral Antigens- Hepatitis B Surface Antigens

Preservative

Sterile filtered solution containing 50mM potassium phosphate.

AA Sequence

MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNH SPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGP CKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFV QWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PAR2 (Protease Activated Receptor 2) Human ELISA Kit
F6860 96 Tests

PAR2 (Protease Activated Receptor 2) Human ELISA Kit

Sign In for Pricing
View Details
Anti-Enterovirus 68, Capsid (Clone EV-D68-159) Purified No Carrier Protein
12-8401-1 1 mg

Anti-Enterovirus 68, Capsid (Clone EV-D68-159) Purified No Carrier Protein

Sign In for Pricing
View Details
DDX58 Polyclonal Antibody, Biotin Conjugated
bs-0993R-Biotin-01 20 µL

DDX58 Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details
DDX58 Polyclonal Antibody, Biotin Conjugated
bs-0993R-Biotin-02 100 µL

DDX58 Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details
Lentiviral human PCYOX1L shRNA (UAS) - Lentiviral human PCYOX1L shRNA (UAS, iRFP) (100)
GTR15325098 1 Vial

Lentiviral human PCYOX1L shRNA (UAS) - Lentiviral human PCYOX1L shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
LHX3 Antibody (FITC)
orb516895-01 50 µg

LHX3 Antibody (FITC)

Sign In for Pricing
View Details