Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HBsAg adw2 Protein

Recombinant of HBsAg adw2 protein

Product Specifications

Source

Escherichia Coli

Purity

Greater than 90.0% as determined by SDS-PAGE.

Form

Sterile filtered colorless solution.

Storage Conditions

Stability: Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA) . Avoid multiple freeze-thaw cycles

Notes

For research use only.

Applications Notes

Viral Antigens- Hepatitis B Surface Antigens

Preservative

Sterile filtered solution containing 50mM potassium phosphate.

AA Sequence

MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNH SPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGP CKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFV QWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Camel Short Palate, Lung and Nasal Epithelium Carcinoma Associated Protein 1 (SPLUNC1) ELISA Kit
MBS9352167-01 48 Well

Camel Short Palate, Lung and Nasal Epithelium Carcinoma Associated Protein 1 (SPLUNC1) ELISA Kit

Sign In for Pricing
View Details
Camel Short Palate, Lung and Nasal Epithelium Carcinoma Associated Protein 1 (SPLUNC1) ELISA Kit
MBS9352167-02 96 Well

Camel Short Palate, Lung and Nasal Epithelium Carcinoma Associated Protein 1 (SPLUNC1) ELISA Kit

Sign In for Pricing
View Details
Camel Short Palate, Lung and Nasal Epithelium Carcinoma Associated Protein 1 (SPLUNC1) ELISA Kit
MBS9352167-03 5x 96 Well

Camel Short Palate, Lung and Nasal Epithelium Carcinoma Associated Protein 1 (SPLUNC1) ELISA Kit

Sign In for Pricing
View Details
Camel Short Palate, Lung and Nasal Epithelium Carcinoma Associated Protein 1 (SPLUNC1) ELISA Kit
MBS9352167-04 10x 96 Well

Camel Short Palate, Lung and Nasal Epithelium Carcinoma Associated Protein 1 (SPLUNC1) ELISA Kit

Sign In for Pricing
View Details
Rat Rps7 ELISA Kit
ELI-41247r 96 Tests

Rat Rps7 ELISA Kit

Sign In for Pricing
View Details
Guinea Pig Troponin T ELISA Kit
MBS7258173-01 48 Well

Guinea Pig Troponin T ELISA Kit

Sign In for Pricing
View Details