Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HBsAg adw2 Protein

Recombinant of HBsAg adw2 protein

Product Specifications

Source

Escherichia Coli

Purity

Greater than 90.0% as determined by SDS-PAGE.

Form

Sterile filtered colorless solution.

Storage Conditions

Stability: Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA) . Avoid multiple freeze-thaw cycles

Notes

For research use only.

Applications Notes

Viral Antigens- Hepatitis B Surface Antigens

Preservative

Sterile filtered solution containing 50mM potassium phosphate.

AA Sequence

MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNH SPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGP CKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFV QWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) UGT79B3 Polyclonal Antibody
MBS9010718 Inquire

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) UGT79B3 Polyclonal Antibody

Sign In for Pricing
View Details
MYC (V-myc Myelocytomatosis Viral Oncogene Homolog (avian), bHLHe39, c-Myc) (Biotin)
249055-Biotin 100 µL

MYC (V-myc Myelocytomatosis Viral Oncogene Homolog (avian), bHLHe39, c-Myc) (Biotin)

Sign In for Pricing
View Details
DSG1 Antibody : HRP (OAAF04694-HRP)
OAAF04694-100UG-HRP 100 µg

DSG1 Antibody : HRP (OAAF04694-HRP)

Sign In for Pricing
View Details
J20-25-2475 Pre-sized Labels for Printers
152797 80 Roll (80 Label (s) x 1 Roll)

J20-25-2475 Pre-sized Labels for Printers

Sign In for Pricing
View Details
MPZL3 Human shRNA Lentiviral Particle (Locus ID 196264)
TL318060V 500 µL Each

MPZL3 Human shRNA Lentiviral Particle (Locus ID 196264)

Sign In for Pricing
View Details
VEGFB polyclonal antibody
orb1787343-01 50 µL

VEGFB polyclonal antibody

Sign In for Pricing
View Details