Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HBsAg preS1 Protein

Recombinant of HBsAg preS1 protein

Product Specifications

Source

Escherichia Coli

Purity

Greater than 97.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.

Solubility

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at <-20°C. Further dilutions should be made in appropriate buffered solutions.

Storage Conditions

Stability: This lyophilized HBsAg preparation is stable at 2-8°C, but should be kept at -20°C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8°C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20°C to -70°C. Avoid repeated freeze/thaw cycles

Notes

For research use only.

Applications Notes

Viral Antigens- Hepatitis B Surface Antigens

Preservative

HBsAg protein was lyophilized from 0.2μm filtered (1mg/ml) solution in 20mM PB, pH 7.4, and 50mM NaCl.

AA Sequence

MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEAHQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Reagecon Neutral Detergent Fibre (NDF) Solution
NDF10 10 L

Reagecon Neutral Detergent Fibre (NDF) Solution

Sign In for Pricing
View Details
Mouse Monoclonal HLA DRB1 Antibody (SPM423) [DyLight 680]
NBP3-11552FR 0.1 mL

Mouse Monoclonal HLA DRB1 Antibody (SPM423) [DyLight 680]

Sign In for Pricing
View Details
NEIL3 Peptide - middle region (AAP75647)
AAP75647-100UG 100 µg

NEIL3 Peptide - middle region (AAP75647)

Sign In for Pricing
View Details
Inhibitor mmu-miR-466n-3p AAV miRNA Vector
Amm3077300 500 ng

Inhibitor mmu-miR-466n-3p AAV miRNA Vector

Sign In for Pricing
View Details
Recombinant Gallid herpesvirus 2 Envelope glycoprotein M (MDV022), partial
MBS7101725 Inquire

Recombinant Gallid herpesvirus 2 Envelope glycoprotein M (MDV022), partial

Sign In for Pricing
View Details
TrpB Antibody
orb833866 2 mg

TrpB Antibody

Sign In for Pricing
View Details