Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HBsAg preS2 Protein

Recombinant of HBsAg preS2 protein

Product Specifications

Source

E.coli

Purity

Greater than 95.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.

Solubility

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at <-20°C. Further dilutions should be made in appropriate buffered solutions.

Storage Conditions

Stability: This lyophilized preparation is stable at 2-8°C, but should be kept at -20°C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8°C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20°C to -70°C. Avoid repeated freeze/thaw cycles

Notes

For research use only.

Applications Notes

Viral Antigens- Hepatitis B Surface Antigens

Preservative

HBsAg protein was lyophilized from 0.2μm filtered (1mg/ml) solution in 20mM PB, pH 7.4 and 50mM NaCl.

AA Sequence

MQWNSTTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTTASP ISSIFSRTGDPAPN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Plekha7 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K4706206 1.0 µg DNA

Plekha7 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Maz Mouse qPCR Primer Pair (NM_010772)
MP208475 200 Reactions

Maz Mouse qPCR Primer Pair (NM_010772)

Sign In for Pricing
View Details
CHST1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
16137111 3x 1.0 µg

CHST1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
IgM Immunoglobulin (Cocktail), CF740 conjugate, 0.1mg/mL
BNC740762-500 1x 500 µL

IgM Immunoglobulin (Cocktail), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CBR3 Rabbit pAb
E45R27486N-50 50 µL

CBR3 Rabbit pAb

Sign In for Pricing
View Details
NCAM (1213C3.D5)
sc-59862 200 µg/mL

NCAM (1213C3.D5)

Sign In for Pricing
View Details