Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HBsAg preS2 Protein

Recombinant of HBsAg preS2 protein

Product Specifications

Source

E.coli

Purity

Greater than 95.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.

Solubility

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at <-20°C. Further dilutions should be made in appropriate buffered solutions.

Storage Conditions

Stability: This lyophilized preparation is stable at 2-8°C, but should be kept at -20°C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8°C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20°C to -70°C. Avoid repeated freeze/thaw cycles

Notes

For research use only.

Applications Notes

Viral Antigens- Hepatitis B Surface Antigens

Preservative

HBsAg protein was lyophilized from 0.2μm filtered (1mg/ml) solution in 20mM PB, pH 7.4 and 50mM NaCl.

AA Sequence

MQWNSTTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTTASP ISSIFSRTGDPAPN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

STNL P032-148x210-PE-CRD/1 AC Signs
826201 Card of 1 Pictogram(s)

STNL P032-148x210-PE-CRD/1 AC Signs

Sign In for Pricing
View Details
1- (3-Fluoropyridin-2-yl) -4-methyl-1H-pyrazol-3-amine
PDC50905-01 50 mg

1- (3-Fluoropyridin-2-yl) -4-methyl-1H-pyrazol-3-amine

Sign In for Pricing
View Details
1- (3-Fluoropyridin-2-yl) -4-methyl-1H-pyrazol-3-amine
PDC50905-02 0.5 g

1- (3-Fluoropyridin-2-yl) -4-methyl-1H-pyrazol-3-amine

Sign In for Pricing
View Details
Macrophage Inflammatory Protein 4 Alpha (MIP4a) Polyclonal Antibody
CAU24707-01 100 µL

Macrophage Inflammatory Protein 4 Alpha (MIP4a) Polyclonal Antibody

Sign In for Pricing
View Details
Macrophage Inflammatory Protein 4 Alpha (MIP4a) Polyclonal Antibody
CAU24707-02 200 µL

Macrophage Inflammatory Protein 4 Alpha (MIP4a) Polyclonal Antibody

Sign In for Pricing
View Details
Macrophage Inflammatory Protein 4 Alpha (MIP4a) Polyclonal Antibody
CAU24707-03 1 mL

Macrophage Inflammatory Protein 4 Alpha (MIP4a) Polyclonal Antibody

Sign In for Pricing
View Details