Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HIV-1 gp41 Long Protein

Recombinant of HIV-1 gp41 Long protein

Product Specifications

Source

Escherichia Coli

Field of Research

Infectious Disease & Virology

Purity

Greater than 95.0% as determined by HPLC analysis & SDS-PAGE.

Form

Sterile filtered colorless clear solution.

Storage Conditions

Stability: HIV-1 gp41 Long although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles

Notes

For research use only.

Applications Notes

Viral Antigens- Human Immunodeficiency Virus

Preservative

8M Urea, 20mM Tris-HCl pH 8.0, 10mM b-mercaptoethanol.

AA Sequence

IEFPGIFRPGGGDMRDNWRSELYKYKVVKIEPLGVAPTKAKRRVVQ REKRAVGIGALFLGFLGAAGSTMGAASMTLTVQARQLLSGIVQQQNNLLR AIEAQQHLLQLTVWGIKQLQARILAVERYLKDQQLLGIWGCSGKLICTTAVPWNASWSN KSLEQIWNNMTWMEWDREINNYTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWFNITNWLWYIKLFIMIVGGLVGLRIVFAVLSVVNRVRQGYSPLSFQTHLPIPRGPDRPEGIEEEGGERDRDRSIRLVNGSLALIWDDLRSLCLFSYHRLRDLLLIVTRIVELLGRRGWEALKYWWNLLQYWSQELKNSAVSLLNATAIAVAEGTDRVIEVVQGAYRAIRHIPRRIRQGLERILL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal anti-Human CD126 (IL-6Ra) Antibody
xAP-0082 100 µg

Mouse Monoclonal anti-Human CD126 (IL-6Ra) Antibody

Sign In for Pricing
View Details
OSCP Double Nickase Plasmid (h)
sc-404116-NIC 20 µg

OSCP Double Nickase Plasmid (h)

Sign In for Pricing
View Details
MRM1 Protein Lysate (Human) with C-Ha Tag
30424031 100 µg

MRM1 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
VprBP Protein Vector (Human) (pPM-C-HA)
PV045807 500 ng

VprBP Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Peptide Chain Release Factor 1, Mitochondrial (MTRF1) Antibody
abx113824 100 µL

Peptide Chain Release Factor 1, Mitochondrial (MTRF1) Antibody

Sign In for Pricing
View Details
TRK-T3 (H-11) Alexa Fluor® 594
sc-515054 AF594 200 µg/mL

TRK-T3 (H-11) Alexa Fluor® 594

Sign In for Pricing
View Details