Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HIV-1 gp41 Long Protein

Recombinant of HIV-1 gp41 Long protein

Product Specifications

Source

Escherichia Coli

Field of Research

Infectious Disease & Virology

Purity

Greater than 95.0% as determined by HPLC analysis & SDS-PAGE.

Form

Sterile filtered colorless clear solution.

Storage Conditions

Stability: HIV-1 gp41 Long although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles

Notes

For research use only.

Applications Notes

Viral Antigens- Human Immunodeficiency Virus

Preservative

8M Urea, 20mM Tris-HCl pH 8.0, 10mM b-mercaptoethanol.

AA Sequence

IEFPGIFRPGGGDMRDNWRSELYKYKVVKIEPLGVAPTKAKRRVVQ REKRAVGIGALFLGFLGAAGSTMGAASMTLTVQARQLLSGIVQQQNNLLR AIEAQQHLLQLTVWGIKQLQARILAVERYLKDQQLLGIWGCSGKLICTTAVPWNASWSN KSLEQIWNNMTWMEWDREINNYTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWFNITNWLWYIKLFIMIVGGLVGLRIVFAVLSVVNRVRQGYSPLSFQTHLPIPRGPDRPEGIEEEGGERDRDRSIRLVNGSLALIWDDLRSLCLFSYHRLRDLLLIVTRIVELLGRRGWEALKYWWNLLQYWSQELKNSAVSLLNATAIAVAEGTDRVIEVVQGAYRAIRHIPRRIRQGLERILL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ASCL4 3'UTR Lenti-reporter-Luc Vector
12528081 1.0 µg

ASCL4 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
CDC25B Antibody (S353) Blocking Peptide
MBS9226725-01 0.5 mg

CDC25B Antibody (S353) Blocking Peptide

Sign In for Pricing
View Details
CDC25B Antibody (S353) Blocking Peptide
MBS9226725-02 5x 0.5 mg

CDC25B Antibody (S353) Blocking Peptide

Sign In for Pricing
View Details
Hmgn2 ORF Vector (Mouse) (pORF)
ORF047300 1.0 µg DNA

Hmgn2 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
MYL6 Antibody
CSB-PA020004-01 50 µg

MYL6 Antibody

Sign In for Pricing
View Details
MYL6 Antibody
CSB-PA020004-02 100 µg

MYL6 Antibody

Sign In for Pricing
View Details