Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HIV-1 gp41 Long Protein

Recombinant of HIV-1 gp41 Long protein

Product Specifications

Source

Escherichia Coli

Field of Research

Infectious Disease & Virology

Purity

Greater than 95.0% as determined by HPLC analysis & SDS-PAGE.

Form

Sterile filtered colorless clear solution.

Storage Conditions

Stability: HIV-1 gp41 Long although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles

Notes

For research use only.

Applications Notes

Viral Antigens- Human Immunodeficiency Virus

Preservative

8M Urea, 20mM Tris-HCl pH 8.0, 10mM b-mercaptoethanol.

AA Sequence

IEFPGIFRPGGGDMRDNWRSELYKYKVVKIEPLGVAPTKAKRRVVQ REKRAVGIGALFLGFLGAAGSTMGAASMTLTVQARQLLSGIVQQQNNLLR AIEAQQHLLQLTVWGIKQLQARILAVERYLKDQQLLGIWGCSGKLICTTAVPWNASWSN KSLEQIWNNMTWMEWDREINNYTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWFNITNWLWYIKLFIMIVGGLVGLRIVFAVLSVVNRVRQGYSPLSFQTHLPIPRGPDRPEGIEEEGGERDRDRSIRLVNGSLALIWDDLRSLCLFSYHRLRDLLLIVTRIVELLGRRGWEALKYWWNLLQYWSQELKNSAVSLLNATAIAVAEGTDRVIEVVQGAYRAIRHIPRRIRQGLERILL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPF1 rabbit pAb
ES10184-01 50 µL

RPF1 rabbit pAb

Sign In for Pricing
View Details
RPF1 rabbit pAb
ES10184-02 100 µL

RPF1 rabbit pAb

Sign In for Pricing
View Details
Vimentin Mouse Monoclonal Antibody (IHC Gold)
E44H20105 250 µL

Vimentin Mouse Monoclonal Antibody (IHC Gold)

Sign In for Pricing
View Details
Mouse Spermine oxidase (SMOX) ELISA Kit
AE18069MO-01 48 Tests

Mouse Spermine oxidase (SMOX) ELISA Kit

Sign In for Pricing
View Details
Mouse Spermine oxidase (SMOX) ELISA Kit
AE18069MO-02 96 Tests

Mouse Spermine oxidase (SMOX) ELISA Kit

Sign In for Pricing
View Details
JMJD1C Antibody, FITC conjugated
A56018-50UG 50 µg

JMJD1C Antibody, FITC conjugated

Sign In for Pricing
View Details