Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HIV-1 gp41 Long Protein

Recombinant of HIV-1 gp41 Long protein

Product Specifications

Source

Escherichia Coli

Field of Research

Infectious Disease & Virology

Purity

Greater than 95.0% as determined by HPLC analysis & SDS-PAGE.

Form

Sterile filtered colorless clear solution.

Storage Conditions

Stability: HIV-1 gp41 Long although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles

Notes

For research use only.

Applications Notes

Viral Antigens- Human Immunodeficiency Virus

Preservative

8M Urea, 20mM Tris-HCl pH 8.0, 10mM b-mercaptoethanol.

AA Sequence

IEFPGIFRPGGGDMRDNWRSELYKYKVVKIEPLGVAPTKAKRRVVQ REKRAVGIGALFLGFLGAAGSTMGAASMTLTVQARQLLSGIVQQQNNLLR AIEAQQHLLQLTVWGIKQLQARILAVERYLKDQQLLGIWGCSGKLICTTAVPWNASWSN KSLEQIWNNMTWMEWDREINNYTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWFNITNWLWYIKLFIMIVGGLVGLRIVFAVLSVVNRVRQGYSPLSFQTHLPIPRGPDRPEGIEEEGGERDRDRSIRLVNGSLALIWDDLRSLCLFSYHRLRDLLLIVTRIVELLGRRGWEALKYWWNLLQYWSQELKNSAVSLLNATAIAVAEGTDRVIEVVQGAYRAIRHIPRRIRQGLERILL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ttc30a1 Mouse shRNA Plasmid (Locus ID 78802)
TL505301 1 Kit

Ttc30a1 Mouse shRNA Plasmid (Locus ID 78802)

Sign In for Pricing
View Details
Phospho-CARM1 (Ser228) Polyclonal Antibody, APC Conjugated
bs-5285R-APC 100 µL

Phospho-CARM1 (Ser228) Polyclonal Antibody, APC Conjugated

Sign In for Pricing
View Details
Rabbit Polyclonal ST3GAL6 Antibody [Alexa Fluor 532]
NBP1-77353AF532 0.1 mL

Rabbit Polyclonal ST3GAL6 Antibody [Alexa Fluor 532]

Sign In for Pricing
View Details
P2RY12 Protein Vector (Human) (pPB-N-His)
PV029810 500 ng

P2RY12 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
Z-Gly-OH
sc-258349 25 g

Z-Gly-OH

Sign In for Pricing
View Details
Agpat3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K4571408 1.0 µg DNA

Agpat3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details