Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HIV-1 Integrase Protein

Recombinant of HIV-1 Integrase protein

Product Specifications

Source

Escherichia Coli

Field of Research

Infectious Disease & Virology

Purity

Greater than 95.0% as determined by SDS-PAGE.

Form

Sterile filtered colorless clear solution.

Storage Conditions

Stability: HIV-1 Integrase although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles

Notes

For research use only.

Applications Notes

Applications: HIV-1 Integrase antigen is suitable for ELISA and Western blots, excellent antigen for early detection of HIV seroconvertors with minimal specificity problems

Preservative

1.5M urea, 25mM Tris-HCl pH 8.0, 0.2% Triton-X & 50% Glycerol.

AA Sequence

MFLDGIDKAQEEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFILKLAGRWPVKTIHTDNGSNFTSTTVKAACWWAGIKQEFGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRDPLWKGPAKLLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVASRQDEDHHHHHH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ELISA Kit for Kallikrein 9 (KLK9)
TRV-0046481-01 24 Tests

ELISA Kit for Kallikrein 9 (KLK9)

Sign In for Pricing
View Details
ELISA Kit for Kallikrein 9 (KLK9)
TRV-0046481-02 48 Tests

ELISA Kit for Kallikrein 9 (KLK9)

Sign In for Pricing
View Details
ELISA Kit for Kallikrein 9 (KLK9)
TRV-0046481-03 96 Tests

ELISA Kit for Kallikrein 9 (KLK9)

Sign In for Pricing
View Details
ELISA Kit for Kallikrein 9 (KLK9)
TRV-0046481-04 5x 96 Tests

ELISA Kit for Kallikrein 9 (KLK9)

Sign In for Pricing
View Details
ELISA Kit for Kallikrein 9 (KLK9)
TRV-0046481-05 10x 96 Tests

ELISA Kit for Kallikrein 9 (KLK9)

Sign In for Pricing
View Details
Bovine Carnosine Synthase 1 ELISA Kit
MBS086830-01 48 Well

Bovine Carnosine Synthase 1 ELISA Kit

Sign In for Pricing
View Details