Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HIV Type-O gp41 13kDa Protein

Recombinant of HIV Type-O gp41 13kDa protein

Product Specifications

Source

Escherichia Coli

Field of Research

Infectious Disease & Virology

Purity

Greater than 95.0% as determined by SDS-PAGE.

Form

Sterile Filtered White lyophilized (freeze-dried) powder.

Solubility

It is recommended to reconstitute the lyophilized HIV Type-O gp41 in sterile 18M-cm H2O not less than 100μg/ml, which can then be further diluted to other aqueous solutions.

Storage Conditions

Stability: HIV Type-O gp41 although stable at room temperature for 4 weeks, should be stored below -18°C. Please prevent freeze thaw cycles

Notes

For research use only.

Applications Notes

Viral Antigens- Human Immunodeficiency Virus

Preservative

Lyophilized from 1mg/ml in 20mM Na-carbonate, pH 9.6.

AA Sequence

MGHHHHHHGSVQTHTLLKGIVQQQDNLLRAIQAQQHLLRLSVWGIRQLRARLLALETLI QNQQLLNLWGAKGRLIAYTSVKWNTTWGGGGSIWGNLTWQEWDQQIDNVSSIIYEEIQ KAQDQQEQNEKKLLELDE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BMP And Activin Membrane Bound Inhibitor Homolog (BAMBI), Recombinant, Human, His-Tag
055488-01 10 µg

BMP And Activin Membrane Bound Inhibitor Homolog (BAMBI), Recombinant, Human, His-Tag

Sign In for Pricing
View Details
BMP And Activin Membrane Bound Inhibitor Homolog (BAMBI), Recombinant, Human, His-Tag
055488-02 50 µg

BMP And Activin Membrane Bound Inhibitor Homolog (BAMBI), Recombinant, Human, His-Tag

Sign In for Pricing
View Details
BMP And Activin Membrane Bound Inhibitor Homolog (BAMBI), Recombinant, Human, His-Tag
055488-03 100 µg

BMP And Activin Membrane Bound Inhibitor Homolog (BAMBI), Recombinant, Human, His-Tag

Sign In for Pricing
View Details
BMP And Activin Membrane Bound Inhibitor Homolog (BAMBI), Recombinant, Human, His-Tag
055488-04 200 µg

BMP And Activin Membrane Bound Inhibitor Homolog (BAMBI), Recombinant, Human, His-Tag

Sign In for Pricing
View Details
5ml Precision FAST LR & SY qPCR Master Mix (5 x 1ml)
Z-PFAST-LR-SY-5ML 5 mL

5ml Precision FAST LR & SY qPCR Master Mix (5 x 1ml)

Sign In for Pricing
View Details
Frozen Tissue Sections, Prostate
CS531157 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details