HIV Type-O gp41 13kDa Protein
Recombinant of HIV Type-O gp41 13kDa protein
Product Specifications
Source
Escherichia Coli
Field of Research
Infectious Disease & Virology
Purity
Greater than 95.0% as determined by SDS-PAGE.
Form
Sterile Filtered White lyophilized (freeze-dried) powder.
Solubility
It is recommended to reconstitute the lyophilized HIV Type-O gp41 in sterile 18M-cm H2O not less than 100μg/ml, which can then be further diluted to other aqueous solutions.
Storage Conditions
Stability: HIV Type-O gp41 although stable at room temperature for 4 weeks, should be stored below -18°C. Please prevent freeze thaw cycles
Notes
For research use only.
Applications Notes
Viral Antigens- Human Immunodeficiency Virus
Preservative
Lyophilized from 1mg/ml in 20mM Na-carbonate, pH 9.6.
AA Sequence
MGHHHHHHGSVQTHTLLKGIVQQQDNLLRAIQAQQHLLRLSVWGIRQLRARLLALETLI QNQQLLNLWGAKGRLIAYTSVKWNTTWGGGGSIWGNLTWQEWDQQIDNVSSIIYEEIQ KAQDQQEQNEKKLLELDE
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS7094680 Inquire
Recombinant Lampris guttatus Cytochrome b (mt-cyb), partial
Sign In for Pricing
View Details E45H01798-2 20 µg
ATPBD4 (DPH6) (NM_001141972) Human Over-expression Lysate
Sign In for Pricing
View Details 
K2822705 3x 1.0 µg
MDH1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
Sign In for Pricing
View Details AMM21704V 100 µL
C9orf43 Mouse Monoclonal Antibody [Clone ID: LBI2G6]
Sign In for Pricing
View Details