Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HIV Type-O gp41 13kDa Protein

Recombinant of HIV Type-O gp41 13kDa protein

Product Specifications

Source

Escherichia Coli

Field of Research

Infectious Disease & Virology

Purity

Greater than 95.0% as determined by SDS-PAGE.

Form

Sterile Filtered White lyophilized (freeze-dried) powder.

Solubility

It is recommended to reconstitute the lyophilized HIV Type-O gp41 in sterile 18M-cm H2O not less than 100μg/ml, which can then be further diluted to other aqueous solutions.

Storage Conditions

Stability: HIV Type-O gp41 although stable at room temperature for 4 weeks, should be stored below -18°C. Please prevent freeze thaw cycles

Notes

For research use only.

Applications Notes

Viral Antigens- Human Immunodeficiency Virus

Preservative

Lyophilized from 1mg/ml in 20mM Na-carbonate, pH 9.6.

AA Sequence

MGHHHHHHGSVQTHTLLKGIVQQQDNLLRAIQAQQHLLRLSVWGIRQLRARLLALETLI QNQQLLNLWGAKGRLIAYTSVKWNTTWGGGGSIWGNLTWQEWDQQIDNVSSIIYEEIQ KAQDQQEQNEKKLLELDE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Follistatin (FS)
SIPA759Mu02-01 10 µg

Recombinant Follistatin (FS)

Sign In for Pricing
View Details
Recombinant Follistatin (FS)
SIPA759Mu02-02 50 µg

Recombinant Follistatin (FS)

Sign In for Pricing
View Details
Recombinant Follistatin (FS)
SIPA759Mu02-03 200 µg

Recombinant Follistatin (FS)

Sign In for Pricing
View Details
Recombinant Follistatin (FS)
SIPA759Mu02-04 1 mg

Recombinant Follistatin (FS)

Sign In for Pricing
View Details
Recombinant Follistatin (FS)
SIPA759Mu02-05 5 mg

Recombinant Follistatin (FS)

Sign In for Pricing
View Details
Human RPL13P5 qPCR Primer Pair
QH70709S 200 Tests

Human RPL13P5 qPCR Primer Pair

Sign In for Pricing
View Details