HIV Type-O gp41 13kDa Protein
Recombinant of HIV Type-O gp41 13kDa protein
Product Specifications
Source
Escherichia Coli
Field of Research
Infectious Disease & Virology
Purity
Greater than 95.0% as determined by SDS-PAGE.
Form
Sterile Filtered White lyophilized (freeze-dried) powder.
Solubility
It is recommended to reconstitute the lyophilized HIV Type-O gp41 in sterile 18M-cm H2O not less than 100μg/ml, which can then be further diluted to other aqueous solutions.
Storage Conditions
Stability: HIV Type-O gp41 although stable at room temperature for 4 weeks, should be stored below -18°C. Please prevent freeze thaw cycles
Notes
For research use only.
Applications Notes
Viral Antigens- Human Immunodeficiency Virus
Preservative
Lyophilized from 1mg/ml in 20mM Na-carbonate, pH 9.6.
AA Sequence
MGHHHHHHGSVQTHTLLKGIVQQQDNLLRAIQAQQHLLRLSVWGIRQLRARLLALETLI QNQQLLNLWGAKGRLIAYTSVKWNTTWGGGGSIWGNLTWQEWDQQIDNVSSIIYEEIQ KAQDQQEQNEKKLLELDE
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
ELI-25733h 96 Tests
Human Uncharacterized protein C6orf10, C6orf10 ELISA KIT
Sign In for Pricing
View Details 
36335111 3x 1.0 µg
PDPR sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
Sign In for Pricing
View Details TL313922V 500 µL Each
CHRNA2 Human shRNA Lentiviral Particle (Locus ID 1135)
Sign In for Pricing
View Details 
GTR15359037 1 Vial
Lentiviral human TRAPPC3L sgRNA gene knockout kit - Lentiviral human TRAPPC3L sgRNA gene knockout kit (25)
Sign In for Pricing
View Details