Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HPV 18 Protein

Recombinant of HPV 18 protein

Product Specifications

Product Name Alternative

Papillomavirus, HPV, Papilloma Virus.

Source

E.Coli

Field of Research

Infectious Disease & Virology; Cancer Biology

Purity

Protein is >90% pure as determined by 10% PAGE (Coomassie staining) .

Form

Sterile filtered clear liquid formulation.

Notes

For research use only.

Applications Notes

Viral Antigens- Human Papilloma Virus

Preservative

Recombinant HPV-18 solution in PBS and 2M Urea.

AA Sequence

VDVYLPPPSVARVVNTDDYVTPTSIFYHAGSSRLLTVGNPYFRVPAGGGNKQDIPKVSAYQYRVFRVQLPDPNKFGLPDTSIYNPETQRLVWACAGVEIGRGQPLGVGLSGHPFYNKLDDTESSHAATSNVSEDVRDNVSVDYKQTQLCILGCAPAIGEHWAKGTACKSRPLSQGDCPPLELKNTVLEDGDMVDTGYGAMDFSTLQDTKCEVPLDICQSICKYPDYLQMSADPYGDSMFFCLRREQLFARHFWNRAGTMGDTVPQSLYIKGTGMPASPGSCVYSPSPSGSIVTSDSQLFNKPYWLHKAQGHNNGVCWHNQLFVTVVDTTPSTNLTICASTQSPVPGQYDATKFKQYSRHVEEYDLQFIFQLCTITLTADVMSYIHSMNSSILEDWNFGVPPPPTTSLVDTYRFVQSVAITCQKDAAPAENKDPYDKLKFWNVDLKEKFSLDLDQYPLGRKFLVQAGLRRKPTIGPRKRSAPSATTSSKPA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1- (3-Methoxythian-3-yl) methanamine
HJC28759-01 50 mg

1- (3-Methoxythian-3-yl) methanamine

Sign In for Pricing
View Details
1- (3-Methoxythian-3-yl) methanamine
HJC28759-02 0.5 g

1- (3-Methoxythian-3-yl) methanamine

Sign In for Pricing
View Details
MicroRNA Purification Kit
11020004-1 25 Preparations

MicroRNA Purification Kit

Sign In for Pricing
View Details
Recombinant Tolumonas auensis Protein RecA (recA)
MBS1038057-01 0.02 mg (E-Coli)

Recombinant Tolumonas auensis Protein RecA (recA)

Sign In for Pricing
View Details
Recombinant Tolumonas auensis Protein RecA (recA)
MBS1038057-02 0.02 mg (Yeast)

Recombinant Tolumonas auensis Protein RecA (recA)

Sign In for Pricing
View Details
Recombinant Tolumonas auensis Protein RecA (recA)
MBS1038057-03 0.1 mg (E-Coli)

Recombinant Tolumonas auensis Protein RecA (recA)

Sign In for Pricing
View Details